KEGG   Ursus maritimus (polar bear): 103680384
Entry
103680384         CDS       T03271                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04510  Focal adhesion
umr04520  Adherens junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04670  Leukocyte transendothelial migration
umr04916  Melanogenesis
umr04919  Thyroid hormone signaling pathway
umr04934  Cushing syndrome
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05160  Hepatitis C
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05412  Arrhythmogenic right ventricular cardiomyopathy
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103680384 (CTNNB1)
   04310 Wnt signaling pathway
    103680384 (CTNNB1)
   04390 Hippo signaling pathway
    103680384 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103680384 (CTNNB1)
   04520 Adherens junction
    103680384 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103680384 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103680384 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103680384 (CTNNB1)
   04916 Melanogenesis
    103680384 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103680384 (CTNNB1)
   05205 Proteoglycans in cancer
    103680384 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103680384 (CTNNB1)
   05225 Hepatocellular carcinoma
    103680384 (CTNNB1)
   05226 Gastric cancer
    103680384 (CTNNB1)
   05216 Thyroid cancer
    103680384 (CTNNB1)
   05217 Basal cell carcinoma
    103680384 (CTNNB1)
   05215 Prostate cancer
    103680384 (CTNNB1)
   05213 Endometrial cancer
    103680384 (CTNNB1)
   05224 Breast cancer
    103680384 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103680384 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    103680384 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103680384 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103680384 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103680384 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103680384 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    103680384 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103680384 (CTNNB1)
   05163 Human cytomegalovirus infection
    103680384 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103680384 (CTNNB1)
   05165 Human papillomavirus infection
    103680384 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Arm_2 Atx10homo_assoc Queuosine_synth
Other DBs
NCBI-GeneID: 103680384
NCBI-ProteinID: XP_008708142
UniProt: A0A384DM46
LinkDB
Position
Un
AA seq 780 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGRCLG
KKTCSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAA
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMA
QNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLV
RAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQ
LLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR
MSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHS
GGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcccgaggaagaggatgtggataccacc
caagtcctgtacgagtgggaacagggcttttctcagtccttcactcaagaacaagtagct
gatattgatggtcagtatgcgatgactcgagctcagagggtgcgagctgctatgttccct
gagacgttagatgagggcatgcagatcccatccacacagttcgatgctgctcatcctact
aatgtccagcgtttggctgaaccatcacagatgttgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aacgatgaggaccaggtggtggtgaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcacaat
ctttctcatcaccgtgagggcttgctggccatctttaagtctgggggcagatgcttgggt
aagaaaacatgttcaccagtggattctgtattattttacgccattacaactctccacaac
cttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcagaaa
atggttgccttgctcaacaaaacaaatgttaaattcttggctattacaaccgactgcctt
cagattttagcttacggcaatcaagaaagcaagctgatcattttggctagtggtggacct
caagctttagtaaatataatgaggacctacacttatgagaaactactgtggaccacaagc
agggtactgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagcaggt
ggaatgcaagctttagggcttcacctgacagatccaagtcaacgtcttgttcagaattgt
ctttggactcttaggaatctatcagatgctgcaactaaacaggaagggatggaaggtctt
cttgggaccctcgttcagcttctgggctcagatgatataaatgtggtcacctgtgcagct
ggaattctttctaatctcacttgcaataattataagaacaagatgatggtctgccaagtt
ggtggtatagaggcactcgtgcgtactgtccttcgtgctggtgacagggaggacattact
gagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatggcc
cagaatgctgttcgccttcactatggactaccagttgtggttaaactcctgcacccacca
tcccattggcctctgataaaggctactgtcggattgattcgaaatcttgccctttgtcca
gcaaatcatgcacctctgcgtgagcagggtgccattccgcgactcgttcagttgctggtt
cgtgcccatcaggatacccagcgccgtacatctatgggtggaacacagcagcagtttgtg
gagggggtccgtatggaagaaattgttgaaggttgtactggagcccttcatatcctagct
cgggatgttcacaaccgaattgtaatcagaggactaaacaccattccattgtttgtgcag
ctgctttattctcccattgaaaatatccaaagagtagctgctggggtcctctgtgaactt
gctcaggacaaggaggctgcagaagccatcgaagcggagggagccacagctcctctgaca
gagttacttcactctaggaacgaaggtgtagcaacatatgcagctgctgttttgttccga
atgtctgaggacaagccacaggattacaagaaacggctttcggttgagctgaccagttct
ctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatattggt
gcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcactct
ggtggatatggccaggatgcattgggtatggaccccatgatggagcatgagatgggtggc
caccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccaggac
ctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgacctg
taa

DBGET integrated database retrieval system