KEGG   Ursus maritimus (polar bear): 103680971
Entry
103680971         CDS       T03271                                 

Gene name
TLR3
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103680971 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103680971 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    103680971 (TLR3)
   05160 Hepatitis C
    103680971 (TLR3)
   05171 Coronavirus disease - COVID-19
    103680971 (TLR3)
   05164 Influenza A
    103680971 (TLR3)
   05168 Herpes simplex virus 1 infection
    103680971 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103680971 (TLR3)
   05165 Human papillomavirus infection
    103680971 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:umr04054]
    103680971 (TLR3)
   04090 CD molecules [BR:umr04090]
    103680971 (TLR3)
Pattern recognition receptors [BR:umr04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   103680971 (TLR3)
CD molecules [BR:umr04090]
 Proteins
  103680971 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR TIR_2 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 103680971
NCBI-ProteinID: XP_008708687
UniProt: A0A384DNP2
LinkDB
Position
Un
AA seq 905 aa
MNQSLPFHIHFFLGLLPFWMLCTASTNKCVVKHEVADCSHLKLTQVPDDLPANITVLNLT
HNQLRRLPPANFTRYSQLTILDGGFNTISKLEPELCQKLPLLEMLNLQHNELSHLSDQTF
VFCTNLTELHLMSNSIKNIQNNPFQNLKNLIKLDLSHNGLSSTKLGSQLQLENLQELLLS
NNKINVLRPEELDFLGNSSLKKLELSSNPIKEFSPGCFRAIGKLFGLSLNNAQLTPSLTE
KLCLELSNTSIQNLSLSNTQLYRTSSMTFVGLKHTNLTVLDLSHNNLNVIENESLAWLPH
LEYFFLEYNNIEHLFSHSFYGLLNVRYLDLRHSFAKQSISLASHPKIDDFSFQWLKCLEY
LNMEDNNFPGINSNMFTGLIKLKHLSLSNSFASLRTLTNETFLSLAQSPLVTLNLTKNKI
SKIESSAFFWLGHLQVLDLGLNEIGQELTGQEWRGLENIVEIYLSYNKCLQLTSSSFALV
PSLRRLMLRRVALRNVDSSPSPFHPLRNLTLLDLSNNNIANINAELLEGLEKLEILDLQH
NNLARLWKHANPGGPVHFLKGLSHLHILNLESNGFDEIPAEVFKDLFELKSIDLGLNNLN
IFPPSVFDDQTSLKSLNLQKNLITSVQKNVFGPAFRNLSNLDMSFNPFDCTCESIAWFVN
WINRTHTNISELSSHYLCNTPPQYHGFPVMLFDVSPCKDSAPFELFFIINTSVSLIFIFI
VLLIHFEGWRISFYWNVLVHRILGFKEIDRQPEQFEYAAYIIHAYKDRDWVWEHFFPMEE
KDQTLKFCLEERDFEAGVLELESIVNSIKRSRKTIFVITQNLLKDPLCKRFKVHQAVQQA
IEQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERVNAFHHKLQVALGS
RNSIH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgaaccagagtttaccttttcatatccacttctttttgggactgttgcccttttggatg
ctgtgtacagcctctaccaataaatgtgtcgttaagcacgaagtagctgactgcagtcat
ctgaagttgactcaagtgcctgatgacctcccagcaaacataacagtgttgaatctcacc
cataatcagctcagaagattgccacctgccaattttacaagatatagccaacttactatc
ttggatggaggatttaacaccatctcaaaactggaaccagaattgtgccaaaaactcccc
ctgttggaaatgttgaacctccagcacaatgagctctctcatctttcagatcaaactttt
gtcttctgtacgaatttgactgagctccatctaatgtccaattcaatcaagaatattcaa
aataatccctttcaaaacctgaagaatttaataaaattagacctatctcataatggttta
tcatctactaaattaggaagtcagctccaactggaaaatctccaagagcttctgttatca
aataataaaattaatgtactgagacctgaagaacttgatttccttggtaattcttcttta
aaaaaattagagttgtcatcaaatccaattaaagagttctctccaggatgttttcgtgca
atcggaaaattatttggcctctctctgaacaacgctcaactgacccccagcctcacagag
aagctttgcttggaactgtcaaacacaagcattcagaatctgtccctgagcaacacccag
ctgtacagaacaagcagtatgactttcgttggcctaaagcacacaaatctcaccgtgctc
gatctttcccacaataacttaaatgtgattgagaatgagtcccttgcttggcttccacat
ctagaatatttcttcctggagtataataatatagagcatttgttttctcactccttttat
gggcttctcaatgtgagatacctggatctgcgacactcttttgctaaacaaagcatttcc
cttgcttcgcatcccaagattgatgatttttcctttcagtggctaaaatgtctggagtat
cttaacatggaagacaacaactttccaggcataaacagcaatatgttcacgggactgata
aagctgaaacacttaagtctttccaactccttcgcaagtttgcggactttaaccaatgaa
acctttttgtcccttgctcagtctcctttagtcacactcaatctaaccaaaaacaaaatc
tcaaaaatagagagcagtgcctttttttggttgggccacctacaggtactcgaccttggc
cttaatgaaatcgggcaagaactcacgggccaagaatggagaggtctagaaaatattgtt
gaaatctacctttcctacaacaaatgcctacaactgaccagcagctcttttgcattggtt
cctagcctccgacgactgatgctccgaagagtggcccttcgaaatgtggacagctcccct
tcaccttttcatcctcttcggaacttgactctcctggatctaagcaacaacaacatagcc
aacataaatgctgaactgttggagggtcttgagaagctagaaattctcgatttgcagcat
aacaacttagcaaggctatggaaacatgcaaaccccggcggtcctgttcattttctaaag
ggtctttctcacctccacattcttaacttagagtctaatggctttgatgagatcccagca
gaggtattcaaggacttatttgaattaaagagcattgatctaggattgaataatttaaac
atatttccaccatctgtctttgatgatcagacatctctaaagtcattgaaccttcagaag
aatctcataacatcggttcagaagaatgtttttgggccagccttcaggaacctgagtaat
ttagatatgagctttaatccgtttgattgtacctgtgaaagtattgcctggtttgttaat
tggattaacaggacccataccaacatctctgaactatcaagccattacctctgcaatact
ccacctcagtatcatggcttccccgtgatgctttttgatgtatcaccctgcaaagacagt
gctccctttgaactctttttcataataaataccagtgtctcgttgatttttatctttatc
gtactgctcatccattttgaaggctggaggatatctttttattggaatgttttagtgcat
cgaattcttggtttcaaagaaatagacagacagccagagcagtttgaatatgcagcttat
ataattcatgcctataaagatagggattgggtctgggaacacttctttccaatggaggaa
aaagatcaaactctcaagttttgtcttgaagagagggactttgaggcaggtgtccttgaa
cttgaatcaattgttaatagcatcaagaggagcagaaaaactatttttgttataacacag
aatctattaaaagatccattatgcaaaagattcaaggtgcaccaagcagttcaacaagct
attgaacaaaatctggattcgattatattgatctttcttgaggagatcccagattataaa
ctgaaccatgcactctgtttgcgaagagggatgtttaaatctcactgcatcttgaactgg
ccagttcagaaagaacgggtaaacgcctttcatcataaattgcaggtagcgcttgggtcc
agaaattcaatacattaa

DBGET integrated database retrieval system