Ursus maritimus (polar bear): 103681723 Help Entry 103681723         CDS       T03271                                  Symbol RAB11B Name (RefSeq) ras-related protein Rab-11B   KO K07905   Ras-related protein Rab-11B Organism umr  Ursus maritimus (polar bear) Pathway umr04144   Endocytosis umr04152   AMPK signaling pathway umr04962   Vasopressin-regulated water reabsorption umr05164   Influenza A Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     103681723 (RAB11B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103681723 (RAB11B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     103681723 (RAB11B)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103681723 (RAB11B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103681723 (RAB11B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103681723 (RAB11B)    04031 GTP-binding proteins [BR:umr04031]     103681723 (RAB11B) Membrane trafficking [BR:umr04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     103681723 (RAB11B) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103681723 (RAB11B)   Exosomal proteins of other body fluids (saliva and urine)    103681723 (RAB11B)   Exosomal proteins of colorectal cancer cells    103681723 (RAB11B) GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     103681723 (RAB11B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 AAA_22 GTP_EFTU RsgA_GTPase AAA_16 PduV-EutP ABC_tran AAA_14 NTPase_1 TniB Gtr1_RagA AAA_24 AAA_21 FeoB_N MCM AAA_29 AAA_5 AAA_7 Motif Other DBs NCBI-GeneID:  103681723 NCBI-ProteinID:  XP_040484220 UniProt:  A0A8M1FPD1 LinkDB All DBs Position Unknown AA seq 201 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFADGSPRIPPPAEIYRIVSQKQIADRAAHDESPGNNVVD ISVPPTTDGQKPNKLQCCQNL NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggggacccgggacgacgagtacgactacctattcaaagtggtgctcattggggactcg ggcgtggggaagagcaacctgctatcacgcttcacccgcaacgagttcaacctggagagc aagagcaccatcggcgtggagtttgccacccgcagcatccaggtggacggcaagaccatc aaggcgcagatctgggacaccgccggtcaggagcgctaccgtgccatcacctccgcgtac taccgcggcgcagtgggcgcactgctcgtgtatgacatcgccaagcacctgacctacgag aacgtggagcgctggctgaaggagctgcgggaccacgccgacagcaacatcgtcatcatg ctggtgggcaacaagagtgacctgcgccacctgcgggccgtgcccactgacgaggctcgt gcctttgcagatgggtcaccccgcattcccccacctgcagagatctaccgcatcgtgtca cagaagcagatcgccgaccgcgcagcccacgacgagtcccccggcaacaacgtggtggac atcagcgtgccgcccaccaccgacggacagaaacccaacaagctgcagtgctgccagaac ctgtga

DBGET integrated database retrieval system