KEGG   Ursus maritimus (polar bear): 103682015
Entry
103682015         CDS       T03271                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04068  FoxO signaling pathway
umr04144  Endocytosis
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04380  Osteoclast differentiation
umr04390  Hippo signaling pathway
umr04520  Adherens junction
umr04659  Th17 cell differentiation
umr04926  Relaxin signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05142  Chagas disease
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05220  Chronic myeloid leukemia
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103682015 (TGFBR2)
   04350 TGF-beta signaling pathway
    103682015 (TGFBR2)
   04390 Hippo signaling pathway
    103682015 (TGFBR2)
   04068 FoxO signaling pathway
    103682015 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103682015 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103682015 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    103682015 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103682015 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103682015 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103682015 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103682015 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103682015 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    103682015 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103682015 (TGFBR2)
   05212 Pancreatic cancer
    103682015 (TGFBR2)
   05225 Hepatocellular carcinoma
    103682015 (TGFBR2)
   05226 Gastric cancer
    103682015 (TGFBR2)
   05220 Chronic myeloid leukemia
    103682015 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103682015 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103682015 (TGFBR2)
   05161 Hepatitis B
    103682015 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103682015 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103682015 (TGFBR2)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103682015 (TGFBR2)
Protein kinases [BR:umr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103682015 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103682015
NCBI-ProteinID: XP_008709810
UniProt: A0A384DSQ3
LinkDB
Position
Un
AA seq 644 aa
MPEESMKSRVGDWNNGSLGHFSIYIFCHTGYIRNIKCPTTITLRRLLIDTELRHPQEEAI
PKGRQHSRAHHQCRTSDVLDQNPHFHKVLRWSRRTVKFENENFRTSTYINNDMMVTDNNG
VIKFPQLCKFCDVRSSTCDNQKSCVSNCSITSICEKPHEVCLAVWRKNDENITLETLCHD
PKDTYHGIVLEDSASPKCIMKEKKVLGETFFMCSCSSDECNDYIIFSEEYATNNPDLLLV
IFQVTGVSLLPPLGIAIAVIVTFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDD
RSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEE
YASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVIS
WEDLRKLGSSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLR
LDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNA
VGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLTECWDH
DPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgccagaggaatccatgaagagtcgagtaggtgattggaataatggtagcctcggccac
ttttctatttacattttctgccacactggatacattcgcaacataaaatgtcccaccact
atcactctgcgacggctgctcattgacactgaactgaggcatccccaggaagaggcaatt
ccaaaagggaggcagcactccagagcccatcaccagtgccgcacctccgacgtcctggat
cagaatccgcattttcacaaggtactcaggtggtccagacgcacagtcaagtttgagaac
gaaaacttccggacttcgacctacattaataatgacatgatggtcaccgacaacaatggt
gtcatcaaatttccacaattgtgtaaattttgcgatgtgagatcttccacctgtgacaat
cagaaatcctgcgtgagcaactgcagcattacatccatctgtgagaagccacatgaagtc
tgtctggcggtctggagaaagaatgatgagaacataacactagagacgctttgccatgac
cccaaggacacctaccacggaatcgttctcgaagattctgcttctccaaagtgtattatg
aaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagctctgatgagtgc
aatgactacatcatcttctcggaagaatatgccaccaacaaccctgacctgttgttagtc
atattccaagtgacaggcgtcagcctcctgccaccactgggaatcgccatagccgtcatt
gtcaccttctactgctaccgggttcaccggcagcagaagctgagcccgtcctgggagacc
agcaagccgcggaagctcatggagttcagcgagcacctggccatcattctggaagacgac
cgctccgacatcagctctacctgcgccaacaacatcaaccacaacacagagctgctgccc
attgagctggacaccctggtggggaaaggtcgcttcgccgaggtctacaaggccaagctg
aagcagaacacttcagaacagttcgagaccgtggcggtcaagatcttcccttatgaggag
tacgcctcctggaagacagagaaggacatcttctcagacatcaacctgaagcatgagaac
atcctgcagttcctgacggctgaggagcggaagacagagctggggaagcagtattggctg
atcacagccttccacgccaagggcaacctacaggagtacctcacgcggcacgtcatcagc
tgggaggacctgcgcaagctgggcagctccctcgcccggggcattgctcacctgcacagt
gaccataccctgtgcgggaggcccaagatgcccatcgtgcacagggacctcaagagctcc
aatatcctcgtcaagaacgacctgacctgctgcctgtgtgactttgggctttccctgcgc
ctcgacccgactctgtctgtggatgacctggccaacagtgggcaggtgggaaccgcaaga
tacatggctccagaagtcctagagtccaggatgaatctggagaacgttgaatcctttaag
cagacggatgtctactccatggctctggtactctgggaaatgacatctcgctgcaatgcg
gtgggagaagtgaaagattacgagcctccatttggttccaaggtgcgggagcatccttgt
gttgagagcatgaaggacaacgtgctgagagaccgagggcgaccagaaattcccagctcc
tggctcaaccaccagggcatccagacggtgtgcgaaactctgaccgagtgctgggaccac
gacccggaggcccggctcacggcccagtgcgtggcggagcgcttcagcgaactggagcac
ctggacaggctctcagggaggagctgctccgaggagaagattcccgaagatggctcgctg
aacactaccaaatag

DBGET integrated database retrieval system