KEGG   Vibrio alfacsensis: D1115_22145Help
Entry
D1115_22145       CDS       T05841                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vaf  Vibrio alfacsensis
Brite
KEGG Orthology (KO) [BR:vaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D1115_22145
Enzymes [BR:vaf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D1115_22145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 Thi4 Thioredoxin_9 DAO Chalcone_N Thioredoxin_4 NAD_binding_8 DUF5474
Motif
Other DBs
NCBI-ProteinID: AXY03548
UniProt: A0A347UXG9
LinkDB All DBs
Position
II:1527944..1529512
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEEVRLVVSLDESKASNDILSLANQIAEMSNLIKVERDDNASV
RKPVMAVTNPAKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKDLD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGGLFQNEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDSASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAEKLMGAAHTE
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNIDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLIPNTEWLKDSEVALSERGEIEVGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcaatccaacaacaactcaaacaatatctggctaatgtaaaagaagaa
gttcgtttagtggttagtctagatgaaagcaaagcatcgaatgacattttgtctctagcg
aaccaaatcgcagagatgagcaacctcatcaaggttgaacgtgacgacaacgcaagcgta
cgtaaaccggtgatggcggtaactaacccagcaaaaggcactgcactacgctttgcaggc
ttgccaatgggtcacgaatttacctctctcgtattggcactgcttcactctggcggtcac
ccaatcaaactagaaccagaagtgattgagcaaatcgccgcactagacaaagatctagac
gtagagatcttcatttcactgtcgtgtcaaaactgcccggacgtggttcaagcgttcaac
atgatggcagcgatcaacccgaaagtgaaagcaaccatgatcgacggtggtttgttccaa
aatgaagtgaaacaacgcgacatcatggctgtaccaagcgtattcgtgaacggtgagcta
ttcggtcaaggccgtatgtctctgactgaaatcctaaacaaagtggatgacagcgcgagc
gagaaagcagcgaaagcactgagcgaaaaagacccatacgatgttcttgttgtcggcggt
ggccctggtggtagcgcagctgctctatacgccgctcgtaaaggtattcgcactggcgtt
gtcgctaaacgctttggtggtcaggttatggacaccatggcaatcgagaacttcatttcg
gtaaaacgcactgaaggtccaaaactggcgactgatctagcagaacatctaaaagaatac
gacgttgacgtcgtaactgagcaacaagctgagaagctaatgggcgcagcacacacagaa
gatggtttgattcacattcaacttgaaagcggcgcaacgctgaagagtaagagtgtcatc
ctaagccctggtgcacgctggcgtgaaatgaacgtccctggcgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgcgacggtccactgttcaaaggcaagaaaactgca
gttattggtggtggtaactcaggtatcgaagccgctatcgaccttgcaggtatcgtagaa
cacgtaaccgttcttgaatttgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgaactcgctaccaaatatcgatatcattacgatggcacaaaccacagaagtcgtgggt
gacggtactcgcgtaacaagcttgaagtacaaagatcgcaacacagatgaaatcaaagag
attgaactgtcaggtatctttgttcaaatcggtctaataccaaacacagaatggctaaaa
gattcagaagtagcactatctgagcgcggcgaaattgaagtcggtagccgtggcgaaact
agcctagaaggtgtgttcgcagccggtgacgcaaccaccgttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcatttgactacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system