KEGG   Vibrio alginolyticus: N646_4283Help
Entry
N646_4283         CDS       T02840                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vag  Vibrio alginolyticus
Pathway
vag00473  D-Alanine metabolism
vag00550  Peptidoglycan biosynthesis
vag01100  Metabolic pathways
vag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N646_4283
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N646_4283
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    N646_4283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
    N646_4283
Enzymes [BR:vag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N646_4283
Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
 Precursor biosynthesis
  Amino acid ligase
   N646_4283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGV20092
UniProt: A0A2I3CR65
LinkDB All DBs
Position
2:1324170..1325159
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIEDVHVTRVEIKNEGWMTNQGELVYLDL
NTKQLCSSESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDAIGIPNTPYLFLTRNDEEAHVQAHKAFEKWGKVFVKAARQGSSVGCYSVTEKDKLS
NAVNDAFGFSDQVLVEKAVKPRELEVAAYEMNGQLHITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTQVQLDSIQHASETVFKQMNLRHLSRIDFFLTEDDEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttttactatgcggcggtggctcttctgagcacgagatttcatta
ttgtctgcaaactttgtcgaacaacaactaaatcttattgaagacgttcacgttacacgc
gtagaaataaaaaacgaaggttggatgaccaaccaaggtgagttggtttacttggatctc
aataccaagcagttgtgctcaagtgaatctaatcaaaccattgatttcatcgtgccttgt
atacatggttttcctggcgaaacaggcgacattcaatctctgtttgaaatcgcaggtatt
ccttatcttggctgcgggccagaagcgagtagcaatagtttcaataaaatcacatctaag
ctttggtacgacgctatcggcatacccaatacgccatacttattcttaacgcgaaacgat
gaagaagctcacgttcaagctcataaagcctttgaaaagtggggaaaagtttttgttaaa
gccgctcgccaaggctcttccgttggctgttacagtgtcacagaaaaagacaagctttct
aatgcagtaaatgatgcttttgggttttctgaccaagtgttggttgagaaagcagtaaaa
cctcgagaacttgaagttgctgcatatgagatgaatggccaactacatatcactaagcca
ggcgaggtcatcgcgcctgatggtgctttttactcgtacgatgaaaagtacagcagttca
agtcactcgctcacagaagttgaggcgaagaatctaactcaagtacaattagattccatc
caacacgcgtcagagacggtatttaaacaaatgaatcttcgtcatttatctcgtatcgac
tttttcctaacggaagatgatgagatttacttaaacgaagtaaacacatttccaggaatg
actccgatctcaatgttccctaaaatgcttcaaaacaacgggcacaaatttcatgagttc
ttggaagattgtataaacagtgcaaagtga

DBGET integrated database retrieval system