KEGG   Variovorax sp. PMC12: C4F17_06560Help
Entry
C4F17_06560       CDS       T05380                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00061  Fatty acid biosynthesis
vam00780  Biotin metabolism
vam01100  Metabolic pathways
vam01212  Fatty acid metabolism
Module
vam_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C4F17_06560 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C4F17_06560 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vam01004]
    C4F17_06560 (fabZ)
Enzymes [BR:vam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C4F17_06560 (fabZ)
Lipid biosynthesis proteins [BR:vam01004]
 Fatty acid synthase
  Component type
   C4F17_06560 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT AfsA PS-DH
Motif
Other DBs
NCBI-ProteinID: AVQ84500
UniProt: A0A2P1VH46
LinkDB All DBs
Position
1:complement(1422136..1422585)
Genome map
AA seq 149 aa AA seqDB search
MTTTLDIHQILKLLPHRYPFLLVDRVLDMEKGKRITALKNVTMNEPFFNGHFPHRPVMPG
VLMLEAMAQAAALLSFHSLDIVPDDNTVYYFAAIDGARFKRPVEPGDQLTLEVEIERMKA
GISKFKGRALVGSELACEATLMCAMRQIN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgctcgatatccatcaaatcctcaagctgctgccccaccgctacccgttc
ctgctggtggaccgcgtgctggacatggaaaagggcaagcgcatcacggcgctcaagaac
gtgacgatgaacgagccgttcttcaacggccactttccgcaccgcccggtgatgccgggc
gtgctgatgctcgaagccatggcccaggccgcggcgctgctgtcgttccattcgctcgac
atcgtgccggacgacaacaccgtctattacttcgccgccatcgacggcgcgcgcttcaag
cgccctgtggaacccggcgaccagctcacgctcgaagtcgagatcgaacgcatgaaggcc
ggcatctcgaagttcaagggtcgcgccctggtgggcagcgaacttgcctgcgaggcgacc
ctgatgtgcgcgatgcgccagatcaactga

DBGET integrated database retrieval system