KEGG   Vibrio anguillarum 775: VAA_03573Help
Entry
VAA_03573         CDS       T01536                                 

Definition
(GenBank) Undecaprenyl pyrophosphate synthetase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
van  Vibrio anguillarum 775
Pathway
van00550  Peptidoglycan biosynthesis
van00900  Terpenoid backbone biosynthesis
van01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAA_03573
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAA_03573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:van01006]
    VAA_03573
Enzymes [BR:van01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     VAA_03573
Prenyltransferases [BR:van01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   VAA_03573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEH32510
UniProt: F7YMN9
LinkDB All DBs
Position
I:978067..978822
Genome map
AA seq 251 aa AA seqDB search
MQNSSLSSDVLPQHIAIIMDGNGRWAKAQGKPRVFGHKNGVAAVRRTISTAAKLGIKAVT
LFAFSSENWRRPEAEVGVLMELFITVLSTEVKKLHKNNLRLRVIGDKTRFSSRLQTKIAQ
AEELTSSNSGMVVNIAANYGGKWDITEAMRSIAVKVASGELSPDQIDETLITQSLTMSDI
PEVDLLIRTSGECRISNFMLWQLAYAEMYFTPIYWPEFGEESLIEAVTWFVNRERRFGCT
GEQVKALMEQK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcatccctctcatctgatgtattaccccaacacatcgcaatcattatggac
ggaaatggccgttgggctaaagcacaaggtaaacctcgtgtatttggtcataagaatggt
gtagcagcggtccgaagaacgatttctactgcagcgaaattgggtattaaagccgttact
ttgtttgcctttagcagtgaaaattggcggcgtccggaagctgaagtgggcgtgttgatg
gagttatttattactgtgctatccacagaagtaaaaaagctgcataagaacaatctgcgt
cttagagtcattggtgataaaacacgttttagctcacgcttacaaacaaaaatcgctcag
gcagaagagttaacctcatcaaacagtggcatggtcgttaatatcgccgcaaactatggc
ggaaaatgggatatcacagaagcaatgcgctctatcgcggtcaaagtggcgagcggtgag
ctttctcctgatcagattgacgagacgctgattacacagtcgctaacgatgtctgatatt
cctgaagtggatttgctcattcgtaccagcggtgaatgtcgtattagtaattttatgttg
tggcaattggcctatgcagagatgtactttacgccgatttactggcctgagtttggtgaa
gaaagtttaattgaagcagtgacttggtttgttaaccgtgaacgccgttttggctgcaca
ggggaacaggttaaggcattgatggaacagaaataa

DBGET integrated database retrieval system