KEGG   Vigna angularis (adzuki bean): 108340660Help
Entry
108340660         CDS       T04660                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var03030  DNA replication
var03410  Base excision repair
var03420  Nucleotide excision repair
var03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:var00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108340660
   03410 Base excision repair
    108340660
   03420 Nucleotide excision repair
    108340660
   03430 Mismatch repair
    108340660
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:var03032]
    108340660
   03400 DNA repair and recombination proteins [BR:var03400]
    108340660
Enzymes [BR:var01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108340660
    6.5.1.6  DNA ligase (ATP or NAD+)
     108340660
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108340660
DNA replication proteins [BR:var03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108340660
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108340660
DNA repair and recombination proteins [BR:var03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108340660
   NER (nucleotide excision repair)
    Other NER factors
     108340660
   MMR (mismatch exicision repair)
    Other MMR factors
     108340660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 108340660
NCBI-ProteinID: XP_017433665
LinkDB All DBs
Position
8
AA seq 786 aa AA seqDB search
MLALHFRSSFGSSFRLSFCFSRTVRVPSLVSFPLSLFSVPLRVMSKPPSAFDALMAAAKK
NSKSKTSKLSSPPKKRKSPLSTSSQNPSNPKSPKLPSPPITVEPEQAVKQEEVAKPEAVK
PEPRKVRQLSTSSSKGKTEELKKQVAQLKQKPSSFDPASMIAWEKGEPVPFLFLALAFDM
ISQESGRIVITDIVCNVLRTVMLATPEDLVPVVYLSANRIAPAHEGLELGIGESIISKAL
AEAYGRNENWIKTQYQKKGDLGLVAKESRSSQPMMWKPEALTIRKVFNTFRLIAKESGKD
SQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGYAEQTLLAALGQAAVYTEEHSKPPP
EIQSPFEKASDIVKQVYSVLPDYDKIISALLTEGLWKLPKTCKFTPGVPIRPMLSKAAKS
VTEVLNKFQDVEFTCEYKYDGERAQIHYLENGSVEIYSRQAERNTEKFPDVAAAVSRLKK
TSVSSFILDCEIVAYDRATQKLLSFQTLSTRARKKVEIEDIKVNVCVFAFDLLYLNGQEL
LQENLRVRREHLYASFEEESGFLQFATALTSNDVEEIQNFLDQAVGASCEGLIIKTLNED
ATYEPAKRSLNWLKLKKDYMDNLGDSVDLVPIAAFHGRGKRTGVYGAFLLACYDNNNEEF
QTICKIGTGFSESVLVERSSSLRSQVISKPKSYYRFGETINPDVWFEASEVWEVRAADLT
ISPVHRAAAGIVDPNKGISLRFPRLVRVRHDKAPEQATSSEQIAELYKAQKHNQANKQDD
EDEEDY
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcattgcattttcgatcatcttttggttcttcttttcgtctttctttctgtttc
tctcgaactgttagggttccttctctcgtctctttccctctttctctcttctctgtccct
ctccgcgtcatgtctaagccaccatccgccttcgacgctctcatggccgccgctaagaag
aattccaaatccaaaacatccaagctttcatcacctcccaagaaaagaaaatctccactc
tccacttcctcacaaaaccctagcaaccccaaatctcccaaactgccttctccgcccata
accgttgaaccggagcaagcagttaaacaggaagaagttgctaaaccagaagctgttaag
ccggaaccgcggaaggtacgccaactgtcaacgtcttcttcgaaggggaagacggaggag
ctgaagaagcaagttgcgcagctgaagcagaagccttccagtttcgatcccgcttcgatg
attgcatgggagaagggagagcccgtgccgtttctctttctcgccttggcattcgatatg
atttctcaggaaagtggaagaatagttatcactgacattgtttgcaatgtgctgcggact
gtgatgctggccacgccggaggatcttgttcccgtcgtttacctctccgcaaaccggatt
gcgcctgctcatgaagggttggaattgggaatcggcgagtcgatcatttccaaggcgctc
gcggaggcttatggaaggaacgagaattggattaagactcagtatcagaaaaaaggtgat
ttgggcttggttgccaaagagagccgttcatctcaacctatgatgtggaagcctgaagca
ttaaccatcaggaaggttttcaacacttttcgccttattgctaaggaatctggaaaagac
agtcaagagaaaaaaaagaatcatatcaaggcacttcttgttgctgcaactgactgtgaa
cctcaatatctaattcgtttgcttcagacgaagttgcgaattggttatgcagagcaaact
ctattggctgcactaggccaagctgcggtatacactgaagaacactctaaaccgcctcct
gaaattcagtctccttttgaaaaggcttcggatattgttaaacaagtctattctgttctt
cctgactatgacaaaataatatctgcactgcttacggagggtctatggaagcttccaaag
acttgtaaatttactccaggtgttccaattagacctatgctatcaaaggcagcaaaaagt
gtaactgaagttctgaacaaattccaggatgtggaatttacctgtgaatacaaatacgat
ggagagcgtgcccagatacattacttggagaatggttcagttgagatttacagtagacaa
gcagaacggaacaccgagaagtttcctgatgttgctgctgcagtttcaaggttgaagaaa
acaagtgtatcttcatttattcttgattgtgaaattgttgcatatgaccgtgcaacacaa
aaacttctttctttccagaccctcagtactcgagctcgcaagaaagtagaaattgaagat
ataaaggttaatgtttgtgtatttgcttttgatttgttgtatctaaatggccaagaactt
cttcaggaaaaccttagagtccgcagagagcatctttatgcctcttttgaggaagaatct
ggttttctccagtttgcaacagcattaacttcaaatgatgttgaggagatacagaatttt
cttgaccaagctgttggtgctagttgtgagggattgattattaagacactaaatgaggac
gctacatatgaacctgccaagcgatcactcaactggctaaaactgaagaaagattatatg
gacaatttaggggactctgtagacttggtacctattgctgctttccatgggcgtggaaaa
cgtacaggagtttatggtgccttcctccttgcttgctatgacaacaataatgaagaattt
caaactatttgcaagattggaacgggtttctctgaatctgtacttgtagaacgttcttcc
agtcttcgctctcaagtgatttccaagccgaagtcatactatagatttggggaaacaatc
aatcctgatgtctggtttgaagccagtgaggtgtgggaggtgagagcggcagacctgacc
attagccctgtccaccgtgctgcagcgggcatagtagatccgaacaagggcatctctctt
cgatttccaaggctggttcgagtccggcatgacaaagctcctgaacaggccacatcatct
gagcagattgctgagttgtataaagctcaaaaacacaatcaagcgaataaacaagatgac
gaagatgaagaagattattga

DBGET integrated database retrieval system