KEGG   Vibrio anguillarum NB10: VANGNB10_cI2173cHelp
Entry
VANGNB10_cI2173c  CDS       T03657                                 

Gene name
murF
Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-ala nine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00300  Lysine biosynthesis
vau00550  Peptidoglycan biosynthesis
vau01100  Metabolic pathways
vau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    VANGNB10_cI2173c (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VANGNB10_cI2173c (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VANGNB10_cI2173c (murF)
Enzymes [BR:vau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     VANGNB10_cI2173c (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: CDQ51085
UniProt: A0A1Y0NS18
LinkDB All DBs
Position
1:complement(2525138..2526496)
Genome map
AA seq 452 aa AA seqDB search
MIEVSLQQLTHVLHAQLVGCDVTVSEVSTDTRQIKPGALFVALVGDKFDAHEFAAQAVAS
GAKALLVQRPLAVAVPQLVVTDTKLALGQLGAWVHQQCQTPTAAITGSCGKTTVKEMVAN
ILSAKGRVLFTAGNFNNDIGVPLTLLRSGLNDAYAVIELGANHIGEIAYTTSLVKPDVAL
VNNVAAAHLEGFGSIEGVKQAKGEIYQGLASGATAIINLESHGGERWSAILADKTVKTFS
SRQMADFYARGIRLNEQGEAQFEMITPIGHIDIGLNIVGEHNVSNALAAAALAIELGANL
EEVQYGLAHLAQVKGRVDVTQLSTTVKLIDDSYNASVPAMKAAVDLLNTFSARRWLILGN
MAELGDESLALHRQVGEHAAPFQFDYVLTYGRDAKVISDLCHGLHFESHVDMIAYIEQQL
SQFDQESHTLLVKGANSAGMSKIVAALKEKYS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtctctttacagcaattgacgcacgttttgcatgcacaattggttggttgt
gatgtcaccgtgtctgaggtctcgaccgacacacgtcaaatcaaacccggtgcgctcttt
gttgccttggtcggggataaatttgatgctcatgagtttgctgcacaagcggttgcgtct
ggtgcaaaggcgttattggttcagcgccctttggcggtggcggttcctcaactggtggtt
accgacaccaaactggcgttaggccagcttggcgcttgggttcaccaacagtgtcaaaca
ccgaccgctgcgattacaggcagttgcggtaaaaccacagtcaaagagatggtggcaaat
attttatcagccaaaggccgcgtgctctttactgctggcaattttaataatgatatcggc
gtgccgctcactctgcttcgctctggccttaatgatgcgtatgcggtgattgagttaggg
gcgaaccatattggtgaaattgcttataccacctctttagtgaagccggatgttgcattg
gtgaacaatgttgccgcggcgcatctggaaggttttggctcaattgagggcgtaaaacag
gcgaaaggtgaaatttatcaaggccttgcttcaggtgcgacagccattattaatttagaa
agccacggtggtgagcggtggagcgctattttagcggacaaaaccgttaaaaccttttcc
agccgtcaaatggcagatttttacgcccgtggtattaggcttaacgaacaaggtgaagct
cagtttgaaatgatcacacccatcggtcatattgatattgggctcaatattgtgggtgaa
cataacgtctctaatgcgttggcggcggcggcattagccattgagttgggtgcgaatctt
gaagaggtgcagtacggacttgcgcatctagctcaggtgaaagggcgtgttgatgtcacc
caattgagcacgactgtgaaactgattgatgacagttacaatgccagtgttccagcgatg
aaagcggcggttgatctacttaacactttctctgcaaggcgttggttaattttaggtaat
atggctgagttgggcgatgaaagccttgcacttcatcgtcaagtcggtgaacatgctgca
ccattccagtttgactatgtccttacttacggtcgcgatgcaaaagtgatcagtgaccta
tgccatggcctccattttgaaagtcatgtggacatgattgcttatatcgagcagcaatta
tcacaattcgatcaagagtctcataccttacttgtcaaaggtgcaaacagtgcgggtatg
agtaaaattgtggctgctctcaaggagaaatactcatga

DBGET integrated database retrieval system