KEGG   Vibrio anguillarum NB10: VANGNB10_cII0129
Entry
VANGNB10_cII0129  CDS       T03657                                 

Definition
(GenBank) Oligosaccharide alpha-1,6-glucosidase protein
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00052  Galactose metabolism
vau00500  Starch and sucrose metabolism
vau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VANGNB10_cII0129
   00500 Starch and sucrose metabolism
    VANGNB10_cII0129
Enzymes [BR:vau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     VANGNB10_cII0129
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Other DBs
NCBI-ProteinID: CDQ48026
UniProt: A0A241NKB7
LinkDB
Position
2:147266..148903
AA seq 545 aa
MEPKWWHSAVVYQIYPRSFYDSNHDGIGDLNGIISKLDYLAELGINVIWLSPVYQSPMDD
NGYDISDYQAIAQEFGSMEDMQRLLSEAQKRNIKIVMDLVVNHTSDEHQWFLQAKQSRDN
PYRDYYIWRDAKPDGSVPDDTGSIFGGSAWHWDEQTQQYYFHLFSKRQPDLNWENPKVQQ
EVHSMMNWWIEQGIGGFRLDVIDLIGKEIDKGITGNGPSLHPLLQQMNAATFGNQDLLTV
GETWGATPDIAKLYSAPSRRELSMVFQFEHITLTWEQGDKWSPIPLDLKQFKQVLTKWQI
ELADQGWNSLFWNNHDLPRAVSKYGDDKRYRVESAKMLATSLHFLKGTPYIYQGEEIGMT
NVAFDSLAQYRDIETLNFYRVKTESGVSHQHMLDAIHQNSRDNARTPMQWSADKHGGFTQ
GSPWIEANPNYLKVNVEQALADKQSIYHHYKKLIALRKKHLSIVYGSFTPLFEEHDQVFG
YVREYQGEQIVVVSNFSSATVCLAIPEKFQLRAVECLSSNYQEIEKLEENLVLEPYQSIA
VLIRE
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggaacccaaatggtggcatagcgctgtggtataccaaatatacccgcgcagtttttac
gattctaatcacgatggtatcggcgatttaaatggcattattagtaagcttgattacctt
gcagagttaggcattaacgttatttggctatctcctgtttatcaatctccaatggatgat
aacggttatgatatttctgactaccaagcaatagctcaagagtttggttccatggaagat
atgcagcgtttactgagcgaagcacaaaaacgcaatattaagatagtgatggatcttgtc
gttaatcacacatcggatgaacaccaatggtttttacaagcgaagcaatcgcgagacaat
ccgtatcgagattactacatttggcgggatgcaaaaccggatggcagtgtaccggatgat
acagggtcaatttttggtggcagtgcttggcactgggatgagcaaacgcagcaatattac
ttccaccttttttctaaacgtcagccagatctgaattgggaaaaccctaaagtgcagcaa
gaagtgcacagcatgatgaactggtggattgaacagggtattggtggttttcgattagat
gttattgatttaattggcaaagaaattgataagggcattactggtaatggcccgagcttg
catccgttattacagcaaatgaatgccgccacctttggtaatcaagatctgctgaccgtg
ggagaaacttggggagccacaccagacattgcaaaactgtacagtgcgccgagtcgtcgt
gagttatcgatggttttccaatttgaacacatcactttgacgtgggagcagggtgacaaa
tggagccctattccgttagatcttaagcagtttaaacaggtattaaccaagtggcagatt
gagcttgccgatcagggttggaattcattattttggaataatcatgacctaccacgcgct
gtatctaagtatggtgatgataaacgctaccgagttgaatctgcgaaaatgttggcaacg
agcttacactttctgaaaggcacgccttatatttatcaaggcgaagagattggtatgacg
aatgtggccttcgattcgctcgctcaataccgagacatcgagacgttaaatttttatcgt
gtgaagacagaatcgggcgtttctcatcagcatatgctggatgctattcatcaaaacagc
cgcgataacgctcgaacgccaatgcaatggtcagcggataaacacggcggatttactcaa
ggttctccgtggatagaggcgaatcctaactacctaaaagtcaatgttgaacaagcgctc
gctgataaacaatcgatttaccatcactataaaaagttaattgcactgcgtaaaaaacac
ctgtccatcgtctatggatcgttcacgcctttatttgaagaacatgaccaagtgtttggc
tatgtgcgtgagtaccaaggtgagcaaattgtcgtggtcagtaatttttcatcggccaca
gtttgtttagcaatacccgaaaagtttcaattgagagcggtggagtgtttgagctctaat
tatcaagagattgaaaaattagaagaaaatctagtactcgagccttatcaatccatcgcg
gttttgatcagagagtaa

DBGET integrated database retrieval system