KEGG   Vibrio anguillarum NB10: VANGNB10_cII0481Help
Entry
VANGNB10_cII0481  CDS       T03657                                 

Definition
(GenBank) transposase, ISVa5 (orfB; IS66-family)
  KO
K07484  transposase
Organism
vau  Vibrio anguillarum NB10
Brite
KEGG Orthology (KO) [BR:vau00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    VANGNB10_cII0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TnpB_IS66 Ribosom_S30AE_C
Motif
Other DBs
NCBI-ProteinID: CDQ48378
UniProt: A0A1Y0NUI3
LinkDB All DBs
Position
2:539227..539580
Genome map
AA seq 117 aa AA seqDB search
MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALFLFTNKQRDKIKVLYWD
KTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFTIIGHEPVKINDFTMS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtatgctcagcgctccagacatttacctttatcgtgaaagcgtcgattttaga
aagtccatcaacggtcttgcagcgattatcgaaaatgatacggacttacctcttggcagc
ggtgcgctgttcctgtttaccaataaacagcgcgataagattaaggtactgtactgggat
aaaacaggcttcgccctctggtataaacgccttgaaaaagccaagtataagtggccttca
aaagagaaaaatcaggtgtttaccctcactcaatttgagcttgatagactgctttctggc
ttcacaattatcggccatgaacccgtaaaaataaacgattttacaatgagctaa

DBGET integrated database retrieval system