KEGG   Vibrio anguillarum NB10: VANGNB10_cII0500Help
Entry
VANGNB10_cII0500  CDS       T03657                                 

Definition
(GenBank) putative uncharacterized protein [DNA/RNA helicase (c2-type; DEAD/DEAH box type)]
Organism
vau  Vibrio anguillarum NB10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII DEAD Helicase_C_2 DUF3638
Motif
Other DBs
NCBI-ProteinID: CDQ48397
LinkDB All DBs
Position
2:553836..555275
Genome map
AA seq 479 aa AA seqDB search
MLDFSRLGGTNPVDSSFNPREIFQALPKVSGKFQYPRDVQSQVWTKWYERRNSNNLVIKM
NTGGGKTSVGLLVLKSCLNEKKGPAVYVVPDNYLVDQVVLEAKELGIETTNNPHDPRYLS
GSSILVINIHKLVNGRSVFGVDDEGIKVPIGSIIVDDAHACLDTVDQQFTMEIPSTSPLY
NELRSTFDSVLEKQSHAKYHEILSGDPSAFLQVPFWSWQKQQALVTQTLVKYKNERVIEF
SYPLLKNHLQLANCVFSASKVEISPHFIPISVIPALGQATRKIFMTATLADDSILSTHFG
VNPSELSNPITPDSAGDVGDRMILLPQVINPKITDEDIQQLCKNVSKKHNVVVIAPSTYR
ANQWEDLADLILNSSNISEGVARLKTQHVGLVVLNNRYDGIDLPQAACRLLVIDGLPDAR
NLIDRVKQSSLMSSNYDNVEKIQRIEQGMGRGVRSSDDYCVVLLTGKGLTSTIYTVSAP
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattttagtcggttaggagggacgaatcctgttgatagctctttcaatccacga
gagatatttcaggctcttcctaaggttagtgggaagtttcagtacccgcgtgatgttcaa
agtcaagtttggacaaagtggtatgaaagaaggaactcaaataacttagtgatcaagatg
aatactggcggtggtaaaacgtcagtaggcttgctagtgctaaaaagttgtttaaatgaa
aagaaaggacctgcggtttacgttgtgcctgataactaccttgttgatcaagtcgtatta
gaagctaaagaacttggtattgaaacaactaataatccgcatgatccgagatatctatct
gggagtagcatactagttatcaatatacataagcttgttaatggtcgctctgtttttggt
gttgatgatgaaggaattaaagtacctattgggagcattattgttgatgatgcccatgcg
tgtttagatacagttgatcagcagttcacgatggaaattccctctacttctccgttatac
aatgagctacgttcgacttttgacagcgtcctagaaaagcaaagccatgctaaatatcat
gagatattgagtggcgaccctagtgcgtttttacaagtgcctttctggagctggcaaaag
caacaagcgctagtaacacagacacttgttaaatacaaaaatgagcgtgtcatagagttt
tcatacccactactcaagaaccaccttcagctagcaaactgcgtatttagtgcaagtaaa
gttgagatatctcctcacttcattcctatttcggtgatacctgcattggggcaagcaact
cgtaaaatctttatgactgcaacgcttgcagacgatagcattctctctactcacttcggt
gtgaaccctagtgagttatctaacccgataactccagacagtgctggagatgtcggtgat
cgtatgatcttgctacctcaagtcattaaccctaaaataacagacgaagatatccaacag
ttatgtaaaaatgtttctaaaaaacataacgttgtggtcatcgctccgtccacatatcga
gctaatcaatgggaagatttagctgatctcatattgaactcaagcaatattagtgaaggt
gttgctcgtttgaaaactcaacacgtgggtttagtagtattgaataaccgatatgatgga
attgatctaccccaagccgcatgtaggcttttagttatcgatggtctacccgacgcaaga
aacttgattgatcgagtaaagcagtcctcactgatgtcgagtaattatgacaatgtagaa
aagattcagcggatcgaacaaggtatgggacgtggtgttcgctctagcgatgactactgt
gtggttttactaacaggtaagggactgacaagcactatttatacagtatccgccccatga

DBGET integrated database retrieval system