KEGG   Verrucomicrobia bacterium IMCC26134: IMCC26134_08370
Entry
IMCC26134_08370   CDS       T03830                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
vba  Verrucomicrobia bacterium IMCC26134
Pathway
vba00620  Pyruvate metabolism
vba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC26134_08370
Enzymes [BR:vba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     IMCC26134_08370
SSDB
Other DBs
NCBI-ProteinID: AKC82784
UniProt: A0A0E3YUR0
LinkDB
Position
2197377..2200904
AA seq 1175 aa
MNPVAADSFTASPASIAAKLLPAVADPRDPRLLTYLNLKLREIGQPGVTLPAAAAGTDVA
GLADLVDHFLSIGREKDRLLTKHLCPVDQRIQNYLYSALEEHAEVPRMPTATLVLDRPGL
ARALSLPPSADEHKSSILTSTRLHNGILHNPKSDRRTTQGIFHVAEGGLPIPDDKKAVPA
AVFARLLISALNPPDELLALPYTAAEEKPAHTFVSLYLRPVVVPAVPGYSPARSMETRFF
IPGALVANLDFVENIFGNAGDPALPALDAALDPEEWTGHTGCIVLAPHLNGITKKSLGLP
TWAEATERQRRDGMCWKDENEAYNDGVAFKITCRDASGIVITVISDNYFGYCKKEVKTQI
SFSANLLGNAEEEHAGGALAFPSYDLGEEFQLSALAPVVDHAFEDAVSLLGQRAVLQAGG
WARDSEYPNICYVPADSRFDLRTQRIVWGPANSPSHSIKLLPSVTYILPSGYKVEMVRSE
AGGRWRLRGTTAEGLLCHKPCTVSGGGKSEISKSIADATFSGPVFVSDAARDLELVDALL
ARNYNNRYRNPAANKPTGQSRPILSADRSLGSVVKLLSRSPDYTDEYNAWLGSIPRYLRD
LVLLVKRLHRPEWGSDWRRHFSVDTINGRPGNELKYHGLRTSTQFLRIGYTPEGGWRTFS
LRTDFMPAVKIQAEDDITASAVAPARLVRGLPAAERTEASVKLVHNCETRLFQRPDDAIV
RGYDKHAERDFAGSGSFFSNYEPLSAAAAAEIIDDALGFDAYTEPVKNLFRDFTANPRAA
FMVTPSHPRIVDGKPTKNPRYLQVRPDLLDPRATTLAQIGARLYRRIPSNLPVTFPVGAV
LMGRRQNPPEKGVRALCVFSPIHYQELPEAFMDLIASLTGKSPSTTGAGSEGALTKGPFN
ALPPIYDLNAALVSFLLTDLPAFSTAAGWVGPKLRVDHDVSLLVPELWCRMSRAERDPKY
LIANGYLERCTDWVHDGKAVLASRLGWRITERFVQTFFGRVLSNPSTVFDEDLLRPELQG
ADVFADGMDNIVAAMKSAADNYFADGSIEQACPPLQALLHIMRDGTWQGHGTEAPEFRRL
FDRAEMLKSDWYLARLEAKRQIDAATWEAHARYLEKFLRRANYADIALQLDIKGRLERVA
GNARAARLPTYTQQLVGTLGGEPAVAPAIVRAQKA
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgaatccagtagctgccgactccttcactgcatcgcctgcctccatcgccgccaagctc
ctgcctgctgtcgctgatccgagagacccccgacttctcacttatctgaatctcaagcta
cgagaaatcggacagcctggagtcacgctccccgccgccgccgccggcactgatgtcgct
ggtctcgccgatctcgttgaccactttctctccatcggacgcgaaaaagaccgtctgctc
accaagcacctttgtcccgtcgaccagcgcatccagaactatctctattccgccttggag
gagcatgccgaggtgccgcgcatgcccactgccaccttggttctggatcgtccgggactg
gcccgcgccctctcgctgcccccatcggccgacgagcataaaagctctattctcacctcc
acccgcctacacaacggcatcctgcacaaccccaagtccgaccgtcgcaccacccagggg
atttttcacgtcgccgagggcggattacccattcccgatgataagaaggccgtgccggcc
gcggtttttgcacgtctcctcattagcgccctgaatccgcccgacgagctcctcgccctg
ccctacaccgctgccgaggagaaaccagcgcacacctttgtctcgctttacctccggccc
gtggtggtgccagcggtccccggttactctccggcgcgcagcatggagactcgtttcttc
atccccggagccttggtagccaacctcgacttcgtcgaaaacatcttcggcaacgccggc
gaccccgcgctgcccgccctagatgccgccctcgatcccgaggaatggaccggccacacc
gggtgcatcgtgctcgccccgcatctaaacggcatcaccaagaaatccctcggcctgccc
acctgggcagaggcgaccgagcgccagcgccgggacggcatgtgctggaaggacgagaac
gaagcctacaacgacggcgtggcgttcaagatcacctgtcgtgatgcctcgggcatcgtt
atcacggtcatatccgacaactacttcggctactgcaaaaaagaggtcaaaacccagatt
tctttttccgccaatctactcggtaacgccgaggaagagcacgccggcggcgccctcgcc
ttcccgagctacgatctcggcgaggaattccagctttccgccctcgcccccgtagtcgac
cacgccttcgaagacgcggtcagcctgctgggccagcgcgccgttctacaggccggcgga
tgggcgcgagatagtgagtatccaaatatttgctacgttccagcggattcccgttttgat
ctccgcacccagcgcatcgtctggggaccggctaactctccctcgcactccatcaagctc
cttccttccgtaacctacattctaccttcaggttacaaggttgaaatggttcgctccgag
gcaggggggcgatggcgtttgcgcggcaccaccgccgaaggcctgctgtgccacaaaccc
tgcaccgtttccggcggaggaaaatcggagatatcaaaatccatcgccgacgccactttt
tccggtccggttttcgtgtccgacgccgcccgtgatctcgagctggtggatgccctcctg
gctcgtaactataacaaccgctaccgcaacccggcggccaacaaacccaccggtcagagc
cgccccatactttctgcggaccgctcgttgggatccgtggtcaaacttctctcccgcagc
cccgattataccgacgaatacaatgcctggctgggctcgatcccgcgctacttgcgcgac
ttggtcctgctcgtcaaacgactccaccgtcccgagtggggctcggactggcgtcgtcat
ttttcagtggatacgatcaacggccggccgggcaacgagctcaaataccacggtctgcgc
acgtcgacccagttcctccgcatcggctacacccccgagggtggctggcgcaccttctcc
ctgcgcaccgatttcatgcccgcggtgaaaatccaggccgaggacgacatcaccgcatcc
gccgtcgccccggcccgcctggtccggggcctgcccgccgccgagcgcaccgaagcctcg
gtgaaactcgtccacaactgcgagacccgtctctttcagaggcctgacgacgccatcgtg
cgcggctatgacaaacacgccgaacgcgatttcgccggctccggcagtttcttctccaac
tacgaacccctctccgccgccgccgccgccgagatcatcgacgacgcccttggttttgac
gcctacaccgaaccggttaaaaacctcttccgtgactttacggccaatccccgggccgcg
ttcatggtcacgccctcccatccccgtatcgttgatggcaagcccaccaaaaacccccgc
tacctgcaggttcgcccggatcttctggatcctcgcgcgaccaccctcgcgcagatcggg
gcccgtctctatcgccgcatcccctcgaaccttccggtcactttccccgtgggcgcagtc
cttatgggacgtcgccagaatccgccggaaaagggagttcgcgccctctgtgtgttcagt
ccgattcattaccaggagctgcccgaggccttcatggatcttatcgccagcctcaccggc
aaatccccgtccaccaccggtgccggttccgaaggcgcgctgaccaaggggccgttcaac
gcgctgcctccgatttatgacctcaacgcggcgctggtatcgtttcttctgaccgacttg
cccgccttctccaccgccgccggttgggtgggcccgaagcttcgcgtagatcacgacgta
tccctgctcgttcccgagctctggtgccgcatgtcgcgggctgagcgcgacccgaaatat
ctgatcgccaatggttatcttgagcgttgcacagattgggtgcacgacggcaaggccgtg
ctcgcgtcccgtctcggctggcgcatcaccgagcgttttgtccaaacctttttcggccgc
gtgctgagcaatccatcgacagtgtttgacgaagatctgctccggcccgagctccagggt
gccgacgtttttgccgatggcatggacaacattgtcgccgccatgaagtcagccgctgat
aattactttgccgacggctcgatcgaacaagcctgtcctcccttgcaagccttgctccat
atcatgcgtgatggcacgtggcagggacacggcaccgaggcaccggaattccgccggctc
ttcgaccgcgccgagatgctcaagagcgactggtatctggcccgcctggaggccaaacgc
cagatcgacgccgccacctgggaagcgcacgcgcgctatttggagaagttccttcgccga
gccaactacgccgacatcgcactgcagctcgatatcaaggggcggcttgaacgtgtcgcc
ggcaacgcccgcgcggccaggcttcccacctacacccagcaactcgtcggcacgctgggc
ggcgaaccggcggtcgcccctgcaatcgtccgtgcgcaaaaggcctga

DBGET integrated database retrieval system