KEGG   Variovorax boronicumulans: CKY39_22045
Entry
CKY39_22045       CDS       T05068                                 

Definition
(GenBank) carbazole dioxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00621  Dioxin degradation
vbo01100  Metabolic pathways
vbo01120  Microbial metabolism in diverse environments
vbo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CKY39_22045
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     CKY39_22045
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C
Other DBs
NCBI-ProteinID: ATA57856
UniProt: A0A250DU16
LinkDB
Position
4757979..4759145
AA seq 388 aa
MEAPITFVDDRLLRKVPSWRTYLAAKLGFRNHWYPIKLSREIGESQIVKATLCGENILLK
RIDGKVYALRDRCIHRGVPFSEKLECYTKGTITCWYHGFTYKWETGELCDILASPDSKAI
GRQSVKSYPVQEAKGAVFVFMGDDDVKPHPLCEDVPPMFLDEDLALEGDSYMVQSNWRVG
CENGFDGLHVYIHRTSPLVNDTQRSLPVGHTANSGQIVLHEVDGQPKGVYDEFAHHVSLW
EGQVEGDVVVRGVRNTRTDGVPTRTTAASLWLPGVLRVDDFPDAGRHQFEWYVPVSEDEH
YYLIMIGKRVTNPQEALDHEQEFWNRWKPVSLDGFNNQDIEARLALQKFYSSDKAWLQEM
LIEGDHPIIKWRELCHRHNRGVQRPDHL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggaagcccctatcacgttcgttgacgaccgcttgctgcgcaaggttccatcctggcgc
acctatctggcagcaaagctcggttttcgcaatcattggtatccgatcaagctgtcgcgc
gagatcggcgaatcccagatcgtgaaggccactttgtgtggcgagaacatcttgctcaaa
cgcattgacggaaaggtctatgcactgcgagatcgctgcattcatcgcggcgtccccttt
tcggaaaagctggagtgctacacgaagggcaccatcacctgctggtaccacgggtttacc
tacaagtgggaaaccggtgaactctgcgacatcctcgcctcgcccgacagcaaggcaatt
ggcaggcagagcgtcaagtcgtacccggtccaggaagccaagggggcggtgttcgttttc
atgggtgacgacgatgtcaagccgcacccgctttgcgaggacgtccctccgatgtttctc
gacgaggacctggccctcgaaggcgactcctacatggtccagtccaactggcgcgtgggt
tgcgagaacggtttcgatgggttgcacgtctacatccaccgcacctctccactggtcaac
gacacgcagcgatctctgcccgttggacacactgccaattccgggcaaatcgtcctgcac
gaggtggacgggcagcccaagggggtgtatgacgagttcgcccaccacgtcagcctctgg
gagggtcaggtcgaaggcgacgtcgtcgtccgcggggtgcgcaatacccgaaccgatggt
gtgcctacccgaacgaccgcggcgtcgctgtggctgccgggcgttctgcgggttgacgac
ttcccggacgcgggccgccatcagttcgagtggtacgtccctgtcagcgaggatgagcac
tactacttgatcatgatcggcaagcgggtaaccaatccgcaagaggctctggaccacgag
caggagttctggaatcgatggaaaccagtctctctggacggcttcaacaatcaagacata
gaagctcggctcgcgctgcaaaagttctatagcagcgacaaggcctggctccaggaaatg
ctgatcgagggcgaccatccgatcatcaagtggcgcgaactgtgccatcgccacaaccgc
ggcgttcaacgacccgaccacctctga

DBGET integrated database retrieval system