KEGG   Variovorax boronicumulans: CKY39_28735
Entry
CKY39_28735       CDS       T05068                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00362  Benzoate degradation
vbo01100  Metabolic pathways
vbo01120  Microbial metabolism in diverse environments
vbo01220  Degradation of aromatic compounds
Module
vbo_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKY39_28735
Enzymes [BR:vbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     CKY39_28735
SSDB
Motif
Pfam: ECH_1 ECH_2 PGM1_C
Other DBs
NCBI-ProteinID: ATA56759
UniProt: A0A250DRY0
LinkDB
Position
complement(6225521..6226303)
AA seq 260 aa
MTTPDAPVLTHVDGRVGVITLNRPRQLNALDDALMDALGAALLAFDADAGIGAIVVTGGD
TAFAAGADIAAMADWGYADVVRDDFITRNWETIRRVRKPVIAAVAGVAYGGGCELALACD
IVLAAESARFALPEVKLAMLPGAGGTQRLPRAIGKAKAMEMCLAARVLDAAEADRCGLVS
RVVAPEALMPEALALAARIAGYSLPALVAIKESVNRAWESSLSEGILFERRQLHARFATE
DAREGLRAFLARRPPVFGHR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaccacgcccgacgcccccgtgctcacccatgtcgacggccgcgtcggcgtgatcacg
ctgaaccgcccacgccaactcaacgcgctggacgacgcgctcatggacgccctcggcgcc
gccttgctggccttcgatgccgacgcgggcatcggcgccatcgtcgtcaccggcggcgac
accgccttcgccgccggtgccgacatcgcggccatggccgactggggctacgccgacgtg
gtgcgcgacgacttcatcacccgcaactgggaaaccatccgccgggtgcgcaagcccgtg
atcgccgcggtggccggcgtggcctacggcggcggttgcgagctggcgctggcctgcgac
atcgtgctggccgccgagtcggcgcgcttcgcgctgcccgaggtcaagctcgccatgctg
ccgggcgccggcggcacccagcgcctgccgcgcgccatcggcaaggccaaggcgatggaa
atgtgcctggccgcgcgcgtgctcgacgcggccgaggccgaccgctgcggcctggtgtcg
cgcgtggtcgcgcccgaggcgctcatgcccgaggccctggcgctggccgcgcgcatcgcg
ggctattcgctgccagcgctggtggcgatcaaggagtcggtcaaccgcgcgtgggagtcg
tcgctgtccgaaggcatcctgttcgagcggcgccagctgcacgcgcgcttcgccaccgag
gacgcgcgcgagggcctgcgcgccttcctggcgcggcgcccgcccgtgttcggccaccgg
tga

DBGET integrated database retrieval system