KEGG   Verrucomicrobia bacterium S94: EGM51_17575Help
Entry
EGM51_17575       CDS       T05990                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vbs  Verrucomicrobia bacterium S94
Brite
KEGG Orthology (KO) [BR:vbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGM51_17575 (ahpF)
Enzymes [BR:vbs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGM51_17575 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_oxidored FAD_binding_2 DAO Thi4 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 Glutaredoxin Lycopene_cycl TPP_enzyme_M K_oxygenase CxC7
Motif
Other DBs
NCBI-ProteinID: QBG49118
UniProt: A0A4P6PGY7
LinkDB All DBs
Position
complement(3995532..3997082)
Genome map
AA seq 516 aa AA seqDB search
MLEQAVKDQLKTVYADLKSTYRLRVSAKGHPAEKELLEMLHDVASTSDRISVVEQDSEGL
QFQIERDGDILPIIIRGIPGGHEFTTLILAILNADGKGKQPDDGIRKRIKALKGPIKLVS
YVSTSCVNCPDVVQALNQMALIHDDFQHEMVEGTHFQDEIASRKIQGVPAVFADDTLIHA
GKAELSELLEKLEEHYGANLVETGEIKAYDVAIIGGGPAGASAAIYTARKGLKTAIIAEK
IGGQVNETKGIENLISIPYTEGPHLAQSLFEHISEYPIDILEHRRVEHIDDGDRKTLHMK
GGETVTTGALVLATGAKWRQLGIPGEKENIGRGVAFCPHCDGPFYKDKPVVVVGGGNSGV
EAAIDLAGICSHVTLLEFSEQLKADGVLVDKAQSLDNVTIHTNAAASRILDNGDKVSGIE
FTDRVSNEIRTVQADGIFVQIGLSPNTAPFKELVEMNQMGEIVVDGHCRTNKAGIYAAGD
LTTVPYKQIIIAMGEGAKAGLSAFEDFARGNIQQLD
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagctgttaaagaccaactcaaaaccgtttacgccgacctcaaatccacc
tatcggctgcgggtttccgccaaaggacacccggcggaaaaagagctgctcgaaatgctc
catgacgtcgcctccacttccgaccgcatttccgtcgtcgagcaggattccgaaggcctg
cagtttcagatcgaacgagacggcgacatcctgccgatcattattcgcggcattcccggc
ggccacgaattcaccaccctcattcttgccatcctcaacgccgacggcaaagggaaacag
cccgacgacggtatccgaaaacgcatcaaagcgctgaagggccccattaaactcgtcagt
tatgtttccacctcgtgtgtcaactgcccggatgtggtccaggcactcaaccagatggct
ctgattcacgatgacttccaacatgagatggttgaaggcactcatttccaggatgaaatc
gccagccgtaaaatccagggggttcccgctgtttttgccgatgacaccttaattcatgcc
ggcaaagcggaactctccgaactgcttgaaaaactggaagaacactacggagccaacctc
gttgaaaccggcgaaatcaaggcatacgatgtggccatcatcggcggcggccccgccggt
gcctcggccgcgatctatacggcacgaaaaggattgaaaaccgccattatcgcagaaaag
atcggcggacaggtcaatgaaaccaaaggcatcgaaaatctgatttccatcccctacacc
gaaggcccgcacctcgcacaaagtctctttgaacatatcagcgaatatccgatcgatatc
ctggaacaccgccgcgtagaacacattgacgatggcgatcgcaaaacgctgcatatgaaa
ggtggcgaaactgtaacgaccggcgcactggtgctggccaccggagcaaaatggcgacag
ctcggcatcccgggcgaaaaagaaaatatcggccgcggcgtagccttctgcccgcactgc
gacggccccttctataaagacaaaccggtcgtcgtggtcggcggcggaaactccggcgtt
gaagcggcgattgatcttgccggcatctgctcacacgtcaccctgcttgaattttccgag
cagctgaaagccgacggcgtgcttgtagacaaagcccaatccctcgataatgtaaccatt
cacaccaatgccgccgcctcccgcatactcgataacggcgacaaagtttccggcattgaa
ttcaccgaccgtgtatcgaacgagatccggaccgtgcaggccgacggtattttcgtccag
atcggactgagcccgaataccgcgccattcaaagagctggttgaaatgaaccaaatgggc
gaaatcgtcgtggacggccattgccgcaccaataaagcaggcatttatgccgccggcgat
ttaaccaccgtcccctacaaacagatcatcatcgccatgggtgaaggcgccaaagccgga
ctcagtgcatttgaagatttcgcccgcggaaatatccaacagctggactga

DBGET integrated database retrieval system