KEGG   Vibrio campbellii: M892_15950
Entry
M892_15950        CDS       T02837                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vca  Vibrio campbellii
Brite
Enzymes [BR:vca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M892_15950
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: AGU95712
LinkDB
Position
I:complement(3446791..3447375)
AA seq 194 aa
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVAEAINAAFGSFEEFKAKFTDAAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacacatctct
gcagagactctagatttccaccacggtaagcaccacaacacttacgttgttaagctaaac
ggtcttatccctggtactgagttcgaaggcaaaacactagaagaaatcatcaagacttct
actggtggcgtattcaacaacgcagcacagatctggaaccacacgttctactggcactgt
ctagcgccaaacgcgggcggcgaaccaactggcgcagttgctgaagcaatcaacgcagca
ttcggttctttcgaagaattcaaagcgaagttcactgacgcagcaatcaacaacttcggt
tcttcatggacttggctagttaagaaagctgacggttctctagaaatcgttaacacttct
aacgcagcaacaccactaacagaagaaggtactactccacttctaactgttgacctgtgg
gaacacgcttactacatcgattaccgcaacgtacgtcctgattacatgaacggcttctgg
gctcttgtaaactgggacttcgtagctgagaacctagcgaagtaa

DBGET integrated database retrieval system