KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0203
Entry
Vch1786_II0203    CDS       T01650                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00220  Arginine biosynthesis
vce00250  Alanine, aspartate and glutamate metabolism
vce00270  Cysteine and methionine metabolism
vce00330  Arginine and proline metabolism
vce00350  Tyrosine metabolism
vce00360  Phenylalanine metabolism
vce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vce00401  Novobiocin biosynthesis
vce01100  Metabolic pathways
vce01110  Biosynthesis of secondary metabolites
vce01210  2-Oxocarboxylic acid metabolism
vce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vch1786_II0203
   00270 Cysteine and methionine metabolism
    Vch1786_II0203
   00220 Arginine biosynthesis
    Vch1786_II0203
   00330 Arginine and proline metabolism
    Vch1786_II0203
   00350 Tyrosine metabolism
    Vch1786_II0203
   00360 Phenylalanine metabolism
    Vch1786_II0203
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vch1786_II0203
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Vch1786_II0203
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vce01007]
    Vch1786_II0203
Enzymes [BR:vce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Vch1786_II0203
Amino acid related enzymes [BR:vce01007]
 Aminotransferase (transaminase)
  Class I
   Vch1786_II0203
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: AET28625
LinkDB
Position
2:143546..144727
AA seq 393 aa
MFTHLPAPVLDPILSLSVAFRNDPRPQKVDLGIGVYKNSLGETPIMRAVALAQDKVVASQ
KTKSYVGLAGCEEFNQSMMQLVLGSTLDTERTIAIQTPGASGALRMLGDLMRVAQPDTTV
WITDPSYVNHKPVMEAAGLKVRYYRYFSRETKMVDTEQMLADLAQAGTKDVVLLHGCCHN
PTGADIDFSAWQAITELAQKNGFIPFVDIAYQGFGDGLEQDAQGLRYMAERMEEMLITTS
CSKNFGLYRERTGAAIVIGKNQQEVTNARGKMLTLARSTYTMPPDHGAALVKTVLRDEQL
TAIWKQELSEMQQRLLTLRKNLCNELRNQHNTRQFDFIESHRGMFTVLGFSAEQMGRLRE
EFAIYGVADGRINIAGLTEKDIPYVANAIIHVS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtttactcatttaccagcaccagttttagatccaatactttctctctccgtcgccttt
cgcaatgatcctcgtccacaaaaagtggatcttggaatcggcgtttataaaaacagtctt
ggcgaaacgccaattatgcgtgccgttgcgctggcgcaagataaagtggtggcaagccaa
aaaaccaaatcttatgtcggccttgccggctgtgaagagttcaaccagagcatgatgcag
ctcgtattaggttcaaccttggatacggagcgcacgattgcaatccagactccgggagcc
agcggcgcgctgcgtatgctgggggatttgatgcgtgtggcgcaaccggatactaccgtg
tggatcaccgatcctagttatgtcaaccacaagcccgtgatggaagcggctggtctgaaa
gtacgttactaccgttatttcagccgtgaaaccaaaatggtggataccgaacaaatgttg
gccgatctggcacaagcgggaacgaaagatgtggtgttactgcatggttgttgtcataac
ccgacaggtgccgatatcgatttttctgcgtggcaagcgatcactgagttggcgcagaaa
aacggctttatcccttttgtcgacatcgcctatcaaggttttggtgacggcttagaacaa
gatgcacagggtttgcgttacatggctgagcgcatggaagagatgttgatcacgacatcc
tgctctaagaatttcggcttgtatcgtgagcgtacgggagcggcgattgtgattgggaaa
aatcagcaagaggtgaccaatgcacgcggcaaaatgctgaccttagcgcgttccacttac
actatgccgcccgatcacggtgctgctctcgtcaaaacagtgttaagagatgaacagctc
acggcaatttggaaacaagagttgagtgaaatgcagcaacgtttgttaactctgcgcaaa
aatttgtgtaatgagttgagaaatcaacacaatacgcgacaattcgacttcattgagagc
catagaggcatgtttactgtactgggattcagtgcagagcagatgggaaggctgcgtgaa
gagtttgcgatttatggtgtcgcagatggcagaattaatatcgcagggctgaccgaaaaa
gacattccttatgtggccaatgctattattcatgtgtcgtaa

DBGET integrated database retrieval system