KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_02420Help
Entry
IR04_02420        CDS       T03827                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf00473  D-Alanine metabolism
vcf00550  Peptidoglycan biosynthesis
vcf01100  Metabolic pathways
vcf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IR04_02420
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IR04_02420
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    IR04_02420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcf01011]
    IR04_02420
Enzymes [BR:vcf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IR04_02420
Peptidoglycan biosynthesis and degradation proteins [BR:vcf01011]
 Precursor biosynthesis
  Amino acid ligase
   IR04_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_YheCD Glutaminase ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AJZ98085
UniProt: A0A4S3QLK5
LinkDB All DBs
Structure
PDB: 

Position
II:complement(483289..484293)
Genome map
AA seq 334 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEDQI
APAIEAAFGFSEQVLVEQAVKPRELEVSAYEMNGKLYISKPGEVIAPEGTFYSYEEKYSA
NSHARTVLEAENLTEKHKELIQTYAERVFIHMKLRHLSRIDFFLTQEGQIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLVQCVTNTLVNAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacaacaatcctacttttgtgcggtggcggctcatctgagcacgaaatttct
ctcgtatcagccaactacatccaacaacagcttgaactgactccagagtttcacgtgatt
cgagtcgagatgaaaaaagagggatggttttccgaacaaggagcccttgtatacctcgat
acaaatagcgcaacattaaatagcgataaggcttcctacccaatagattttgttgttcct
tgcatccatggtttcccgggagaaactggggatattcaatccatgttagaactggcaggc
attccttatctaggctgtgggccagaagccagtgcaaacagctttaacaaaatcacgtcc
aaactatggtatgacgcattagatattcctaacacaccgtatctatttttaacccaaaat
acaccaagctcgattgataaagccaagcaagcttttggtcattggggaagtatctttgtc
aaagctgctcgtcagggttcttcagtcggatgctacaaagtaaccacagaagatcagatt
gcccccgccattgaggctgcttttggtttctcagagcaagttcttgtcgagcaagccgtt
aaacctagagagttagaggtttctgcttatgagatgaacggaaaactctatatctcaaaa
ccgggagaagtgattgcaccagaaggtacattctattcatatgaagaaaagtacagtgcg
aatagccacgccagaaccgtcttagaagctgaaaatctaaccgagaaacacaaagaatta
attcaaacatatgctgaacgtgtattcatccatatgaagcttcgtcatttatctcggatc
gactttttcttgactcaagagggacaaatttacctcaatgaggtcaatacatttccagga
atgacaccgatttccatgtttccgaaaatgctagagcataacggacaccgatttagtgaa
ttcctcgtgcaatgtgtcaccaacacattagtaaatgcgaagtag

DBGET integrated database retrieval system