KEGG   Vibrio cholerae O1 MJ-1236: VCD_001900
Entry
VCD_001900        CDS       T00903                                 

Definition
(GenBank) GGDEF domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VCD_001900
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VCD_001900
SSDB
Motif
Pfam: GGDEF HAMP DUF4276
Other DBs
NCBI-ProteinID: ACQ60069
LinkDB
Position
1:956004..957296
AA seq 430 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHQEINAVKLASVDGIVFERTTIPSTYKEQNYWSDANRYR
LDSPVDGNLIGYLMIHEDHQVIRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAEQDTLTGLKNRLGCEKFVLRKQRASTTMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIG
LGQQSAQVGCSIGISHMNSLHIDLEKLLLQADKAMYWVKYRGKHGYHIYRMGEEILPLPS
AKELKQDQFR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgaacttcgccactggttaatcgcttgctgaagatgatttcactg
tgtgcacttgggtatttgctgatcattttggccatcattattccgcgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctccttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgttgctg
cttcatcaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgagcgc
accaccatcccctcaacctacaaagagcagaattattggagtgatgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtgattcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatccgaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtggccaaaagcatcaatgaatttatc
gacgcttcccatcaagctttactgcgtgaacgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccgaacaagacacgctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgctagcaccactatggtgctgctattg
attgatttggatggttttaagcaggtgaatgataccttggggcatgcggctggcgatgag
gtattacgtgaaatcgccaaacgtttttatgccttggcgcaaacacatttttctgatttt
gtggtcggacggctcggtggtgatgagtttgctatttacattccgctggatgaatttgtt
gccgaatctatcgagcggtttgcggctcagttgatcgaatcctcctctgagccgattgga
ttgggtcagcagagtgcgcaagtgggttgcagtatcgggattagtcatatgaacagtctg
cacattgacttagaaaaactgctgctacaagccgataaagccatgtactgggtcaaatac
agaggcaaacatggctatcatatttatcgaatgggggaagagatcctgcctcttcccagt
gcgaaagaactcaagcaggatcagttcagatag

DBGET integrated database retrieval system