KEGG   Vibrio cholerae O1 O395: VC395_2569
Entry
VC395_2569        CDS       T02099                                 

Gene name
vpvC
Definition
(GenBank) GGDEF family protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VC395_2569 (vpvC)
Enzymes [BR:vcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VC395_2569 (vpvC)
SSDB
Motif
Pfam: GGDEF HAMP DUF4276
Other DBs
NCBI-ProteinID: ACP10556
LinkDB
Position
I:complement(2721970..2723262)
AA seq 430 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHQEINAVKLASVDGIVFERTTMPTTYKEQNYWSDANRYR
LDSPVDGNLIGYLMIHEDHQVIRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAEQDTLTGLKNRLGCEKFVLRKQRASTTMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIA
LGQQSAQVGCSIGISHMNSLHIDLEKLLLQADKAMYWVKYRGKHGYHIYRMGEEILPLPS
AKELKQDQFR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgcacttcgccactggttaatcgcttactaaagatgatttcactg
tgtgcgcttgggtatttgctgatcattttggccatcattattccacgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctccttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgctgctg
ctccatcaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgaacga
accaccatgcccacaacctacaaagaacagaattattggagtgatgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtaattcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatccgaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtagccaaaagcatcaatgaatttatc
gacgcttcccatcaagccttgctgcgtgagcgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccgaacaagacactctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgctagcacaaccatggtactgctattg
attgatttggatggttttaagcaggtgaatgataccttggggcatgcggctggtgatgag
gtattacgtgaaatcgctaagcgtttttatgccttggcgcaaacgcacttttctgatttt
gtggtcggacggctcggtggcgatgagtttgctatttacattccgcttgatgaatttgtt
gccgaatctatcgagcggtttgcggctcagttgatcgaatcctcctctgagccgattgca
ttgggtcagcagagtgcgcaagtgggttgcagtatcgggattagtcatatgaacagtctg
cacattgacttagaaaaactgctgctacaagccgataaagccatgtactgggtcaaatac
agaggcaaacatggctatcatatttatcgaatgggggaagagatcctgcctcttcccagt
gcgaaagaactcaagcaggatcagttcagatag

DBGET integrated database retrieval system