KEGG   Vibrio cholerae O1 O395: VC395_A0743Help
Entry
VC395_A0743       CDS       T02099                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr00473  D-Alanine metabolism
vcr00550  Peptidoglycan biosynthesis
vcr01100  Metabolic pathways
vcr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VC395_A0743 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VC395_A0743 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VC395_A0743 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcr01011]
    VC395_A0743 (ddlA)
Enzymes [BR:vcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VC395_A0743 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:vcr01011]
 Precursor biosynthesis
  Amino acid ligase
   VC395_A0743 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_YheCD Glutaminase ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACP11577
UniProt: A5F083
LinkDB All DBs
Structure
PDB: 

Position
II:694133..695122
Genome map
AA seq 329 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEDQI
APAIEAAFGFSEQVLVEQAVKPRELEVSAYEMNGKLYISKPGEVIAPEGTFYSYEEKYSA
NSHARTVLEAENLTEKHKELIQTYAERVFIHMKLRHLSRIDFFLTQEGQIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLAQCVTNT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacaacaatcctacttttgtgcggtggcggctcatctgagcacgaaatttct
ctcgtatcagccaactacatccaacaacagcttgaactgactccagagtttcacgtgatt
cgagtcgagatgaaaaaagagggatggttttccgaacaaggagcccttgtatacctcgat
acaaatagcgcaacattaaatagcgataaggcttcctacccaatagattttgttgttcct
tgcatccatggtttcccgggagaaactggggatattcaatccatgttagaactggcaggc
attccttatctaggctgtgggccagaagccagtgcaaacagctttaacaaaatcacgtcc
aaactatggtatgacgcattagatattcctaacacaccgtatctatttttaacccaaaat
acaccaagctcgattgataaagccaagcaagcttttggtcattggggaagtatctttgtc
aaagctgctcgtcagggttcttcagtcggatgctacaaagtaaccacagaagatcagatt
gcccccgccattgaggctgcttttggtttctcagagcaagttcttgtcgagcaagccgtt
aaacctagagagttagaggtttctgcttatgagatgaacggaaaactctatatctcaaaa
ccgggagaagtgattgcaccagaaggtacattctattcatatgaagaaaagtacagtgcg
aatagccacgccagaaccgtcttagaagctgaaaatctaaccgagaaacacaaagaatta
attcaaacatatgctgaacgtgtattcatccatatgaagcttcgtcatttatctcggatc
gactttttcttgactcaagagggacaaatttacctcaatgaggtcaatacatttccagga
atgacaccgatttccatgtttccgaaaatgctagagcataacggacaccgatttagtgaa
ttcctcgcgcaatgtgtcaccaacacatag

DBGET integrated database retrieval system