KEGG   Vibrio cholerae O1 El Tor MS6: MS6_2186
Entry
MS6_2186          CDS       T03666                                 

Definition
(GenBank) GGDEF domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    MS6_2186
Enzymes [BR:vcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     MS6_2186
SSDB
Motif
Pfam: GGDEF HAMP DUF4276
Other DBs
NCBI-ProteinID: BAP03841
LinkDB
Position
1:complement(2497766..2498854)
AA seq 362 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHQEINAVKLASVDGIVFERTTIPSTYKEQNYWSDANRYR
LDSPVDGNLIGYLMIHEDHQVIRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAEQDTLTGLKNRLGCEKFVLRKQRASTTMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIG
LG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgaacttcgccactggttaatcgcttgctgaagatgatttcactg
tgtgcacttgggtatttgctgatcattttggccatcattattccgcgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctccttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgttgctg
cttcatcaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgagcgc
accaccatcccctcaacctacaaagagcagaattattggagtgatgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtgattcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatccgaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtggccaaaagcatcaatgaatttatc
gacgcttcccatcaagctttactgcgtgaacgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccgaacaagacacgctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgctagcaccactatggtgctgctattg
attgatttggatggttttaagcaggtgaatgataccttggggcatgcggctggcgatgag
gtattacgtgaaatcgccaaacgtttttatgccttggcgcaaacacatttttctgatttt
gtggtcggacggctcggtggtgatgagtttgctatttacattccgctggatgaatttgtt
gccgaatctatcgagcggtttgcggctcagttgatcgaatcctcctctgagccgattgga
ttgggttag

DBGET integrated database retrieval system