KEGG   Vibrio sp. EJY3: VEJY3_04625Help
Entry
VEJY3_04625       CDS       T01683                                 

Definition
(GenBank) amino acid ABC transporter amino acid-binding protein
  KO
K10022  arginine/ornithine transport system substrate-binding protein
Organism
vej  Vibrio sp. EJY3
Pathway
vej02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vej00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VEJY3_04625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vej02000]
    VEJY3_04625
Transporters [BR:vej02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/ornithine transporter
    VEJY3_04625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AEX21421
LinkDB All DBs
Position
1:1056800..1057570
Genome map
AA seq 256 aa AA seqDB search
MKKWLLAATLAATAVSGAVQAKEWKTVRFGVEGAYPPFSWTETDGSLKGFDVDMANALCE
EMQVKCQIVAQDWDGIIPSLLARKYDAIIAAMSITEERKKKVDFTGKYALIPNKFIAKKG
ADLDFDKLDGKKIAVQRATTHDKYLTDNYGDKVEIVRYGSFDEAYLDLANGRVAAVLGDA
SALEEGVLNKAGGDAYEFVGPSLTDPKWFGEGFGIAVRKQDKDLTQKLDAAILSLREKGV
YQQLAGKYFNYDVYGE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtggttattagcagcaacgcttgctgcaacggctgtatctggcgccgttcaa
gcgaaagaatggaaaaccgttcgctttggtgttgaaggtgcataccctccgtttagctgg
actgaaactgatggctctctaaaaggctttgacgttgacatggcaaatgcactttgtgaa
gaaatgcaagtgaagtgtcaaatcgttgctcaagactgggatggcatcattccttctcta
ctggcgcgcaaatacgacgcaatcattgcggcaatgtcgattacagaagagcgcaagaag
aaagttgatttcactggcaaatacgcacttattccaaacaaatttattgcgaagaaaggc
gctgatctagactttgacaaactagacggtaagaaaatcgcggtacagcgtgcaactaca
cacgataaatacctgactgacaactacggtgacaaagttgagatcgtacgttacggctca
tttgatgaagcttatcttgatcttgctaacggtcgtgtagctgctgttctaggtgacgct
tctgctctggaggaaggcgttcttaacaaagctggtggcgatgcgtatgagtttgttggc
ccatctttaacggatcctaaatggtttggtgaaggctttggtatcgcggttcgcaagcaa
gacaaagatttaacgcaaaaactagacgctgcgattctgtcactacgtgagaaaggtgtt
taccaacaacttgctggtaaatacttcaactacgatgtgtacggcgaataa

DBGET integrated database retrieval system