KEGG   Vibrio antiquarius: VEA_001043Help
Entry
VEA_001043        CDS       T01107                                 

Definition
(GenBank) alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vex  Vibrio antiquarius
Brite
KEGG Orthology (KO) [BR:vex00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VEA_001043
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VEA_001043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like DAO FAD_binding_3 Thioredoxin_9 Thi4 Chalcone_N DUF5474 Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACY53728
LinkDB All DBs
Position
2:complement(1180378..1181946)
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEDVRLVVSLDESKASNDILSLANQIAEMSDFITVERDDNASA
RKPVMTVTNPVKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKELD
VEVFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGALFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAQKLMGAAHTE
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKASSLPNVDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagac
gttcgtctagtggttagtctagatgaaagcaaagcatcgaatgacattctgtctctggcg
aaccaaatcgcagagatgagcgactttatcaccgttgaacgtgacgacaacgcaagcgca
cgtaaaccagtgatgacggtgaccaacccagtaaaaggcacagcacttcgctttgctggc
ctaccaatgggtcacgaatttacctctctggtattggcattgctgcactctggtggtcac
ccaatcaaactagagccggaagtgattgaacaaatcgcagcgctagataaagaattggat
gttgaagtgttcatttcactgtcgtgccaaaactgtccagacgttgttcaagcgttcaac
atgatggcggcgatcaacccgaaagtgaaagcaaccatgatcgacggtgcactcttccaa
gatgaagtaaaacaacgtgacatcatggcagtaccaagcgtattcgtgaacggtgagcta
ttcggccaaggtcgtatgtctctgactgaaatcctaaacaaagtggatgacggcgcgagc
gagaaagcagccaaagcactgagcgaaaaagacccatacgacgtgctagttgtcggcggt
ggccctggtggtagtgcagcagcactatacgcagcgcgtaaaggtattcgcactggcgtt
gtcgctaaacgcttcggtggtcaggtgatggacaccatggcaatcgagaactttatctcg
gtaaaacgtactgaaggtccaaaattggcgactgacctagccgagcacctaaaagaatat
gacgtagacgtcgtgactgagcaacaagcgcaaaaactgatgggcgcagcgcacacagaa
gatggcttgattcatatccaacttgaaagcggcgcaacgctgaaaagtaagagtgtcatc
ctaagccctggtgcacgctggcgtgaaatgaacgttccgggcgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgtgacggcccgttgttcaaaggcaagaaaaccgcc
gttatcggtggtggtaactcaggcatcgaagcagctatcgaccttgctggtatcgtagaa
cacgtaacggttcttgaattcgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgagctcactaccaaacgtagacatcatcacgatggcgcaaactactgaagttgtgggt
gacggtactcgcgtaacaagcttgaagtacaaagaccgcaacacagatgaaatcaaagag
attgaactgtcaggtatctttgttcaaatcggtctagtaccaaacacagaatggctaaaa
gattcagaagtagcgctttctgagcgcggcgaaattgaagttggtagccgtggtgaaacc
agcctagaaggtgtcttcgcagcgggtgacgcaacgacggttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcgtttgactacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system