KEGG   Vitreoscilla filiformis: VITFI_CDS0313Help
Entry
VITFI_CDS0313     CDS       T04960                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vff  Vitreoscilla filiformis
Brite
KEGG Orthology (KO) [BR:vff00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VITFI_CDS0313
Enzymes [BR:vff01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VITFI_CDS0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like DAO FAD_binding_2 Thioredoxin_3 FAD_oxidored Thi4 FAD_binding_3 Lycopene_cycl K_oxygenase NAD_binding_8 AlaDh_PNT_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ASM76092
UniProt: A0A221KAQ1
LinkDB All DBs
Position
331030..332601
Genome map
AA seq 523 aa AA seqDB search
MLDTNTQAQLQAYFQRISQPVELVASLDDRPASAEMRELLTEVAAAAPGKISLRVDGQAE
RRPSFQIRRANGAGGEVRFAAIPMGHEFTSLILAVLWAGGHPPKVEPEVIEQIKALEGDF
RFKVYMSLTCHNCPDVVQALHLMATFNPRIQAVAVDGGLFQAEVEAKQIMAVPYVTLNGQ
PFGSGRMEVKDILAKIDTGAAKREAAAMNAKEAFDVLIVGGGPAGAAAAVYAARKGIRTG
LLAERFGGQTLDTLGIENFISVPETQGPKFAAALEAHVRTYDVDVMTQQRVEQLIPAEQT
GGLTTVKLANGGELKGRTVIVATGARWRNMNVPGEAEYKTKGVAYCPHCDGPLFKGKDVA
VIGGGNSGVEAAIDLAGIVKSVTLLEFADQLKADQVLVNKLKSLPNVTIHVNAQTTEVIG
DGQKMTGLRWKDRVSGSEHEAALAGVFVQIGLVPNTEFAKGVVEMNRFGEIMVDAKCHTS
VPGVFAAGDCSTVPYKQIIIATGEGAKAALSAFDHLIRTPAAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaacacccaagcccagctgcaagcctatttccagcgcatcagccagccc
gtggagctggtggccagtttggacgatcgccccgcttcggctgaaatgcgcgagctgctc
accgaagtggccgccgcagcacccggcaagatcagcttgcgcgtcgatggccaggccgaa
cgccgtccctcgttccaaatccgccgggccaacggtgcggggggcgaggtgcgtttcgcc
gccatccccatgggccatgaattcacctcgctgattctggcggtgctgtgggccggtggt
catccacccaaggtcgagccggaggtgatcgagcagatcaaggcgttggagggggacttc
cgcttcaaggtctacatgtccctgacctgccacaactgcccggacgtggtgcaagccctc
cacctcatggccaccttcaacccgcgcatccaagcggtggcggtggatggtgggctgttc
caagccgaggtcgaagccaaacaaatcatggccgtgccctacgtcacgctgaacggtcag
ccgttcggctcgggccgcatggaggtgaaggacatcctcgccaaaatcgacaccggcgcc
gccaagcgcgaagccgccgccatgaacgcgaaggaggccttcgatgtgctgatcgtcggc
ggtggcccggctggcgcggcggcagcggtgtacgcagcgcgcaagggcatccgcaccggt
ttgctggccgagcgtttcggcggtcaaacgctggacacgctgggcatcgaaaacttcatc
tcggtgccggaaacccaaggcccgaaattcgccgccgccctggaagcgcatgtgcgcacc
tacgacgtggatgtgatgacacaacagcgtgtcgaacagctcatccccgccgaacagacc
ggggggctgaccacggtcaaactggccaacggcggcgagttgaagggccgcacggtgatc
gtggccacgggcgcccgctggcgcaacatgaatgtgcccggtgaagccgagtacaaaacc
aagggcgtggcctactgcccgcactgcgacggcccgttgttcaagggcaaggacgtggcg
gtgatcggcggcggtaactccggcgtcgaagcggcgatcgacttggcgggcatcgtcaaa
agcgtgaccttgctcgaattcgccgaccaactgaaggccgatcaggtgctggtgaacaag
ttgaagagcttgcccaacgtcaccatccacgtgaatgcccagaccaccgaagtcatcggc
gatggtcagaagatgaccggcctgcgctggaaggatcgcgtgagcggctccgaacacgaa
gccgcactggcgggggtgtttgtgcagatcggcctggtgcccaacaccgaattcgccaag
ggcgtggtggagatgaaccgcttcggcgaaatcatggtggacgccaagtgccacaccagc
gtgccgggcgtgtttgcggcgggggactgctccacggtgccctacaaacaaatcatcatc
gccacgggcgaaggggccaaggcggcgctgtcggctttcgatcacctgatccgcacgccg
gcagccgcctga

DBGET integrated database retrieval system