KEGG   Aliivibrio fischeri MJ11: VFMJ11_A0273Help
Entry
VFMJ11_A0273      CDS       T00754                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00564  Glycerophospholipid metabolism
vfm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VFMJ11_A0273
Enzymes [BR:vfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VFMJ11_A0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 3HCDH_N GIDA NAD_binding_8 Lycopene_cycl FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACH64530
UniProt: B5ET12
LinkDB All DBs
Position
II:306931..308454
Genome map
AA seq 507 aa AA seqDB search
MNNENQTHIADSVLDVIVVGGGINGAGIAADAAGRGLTVGLYEASDFASATSSASSKLIH
GGLRYLEHYEFRLVSEALAEREVLLAKAPHIAKPMRFRLPHRPFLRPAWMIRAGLFLYDN
LGKRTTLPASHSVDLAASGLLKSEITKGFEYSDCWVDDARLVILNAIAAEKNGAEVKNYC
RVEKAIRVDNIWHVTIFDAQTNARFERKAKALVNAAGPWVKQFFDDSLEDESPRNIRLVK
GSHIVVPKIHDEEQAYILQNKDNRIVFVIPYMEDFSIIGTTDVEYKGDPRKVAISEDEVS
YLIDVVNQHFVEQIKRDDVVWTYSGVRPLCDDESDSPQAITRDYTLELEQELDQAPLLSI
FGGKLTTYRKLGETAMKMLTPYFTKMGTPWTRNVALPGGDFDYPRHQLVDNICSKHQWLA
KETVTRYVNQFGTLTWTLLEGIECQTDMGELFAQGVYQVEIDYLIQHEFAKNEEDVLWRR
TKLGLYLNDEEKATIASYIESNLSRLK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaaaatcaaactcatatagccgattcagttttagacgtcattgttgttggt
ggcggtattaatggcgcaggtattgctgcagatgctgctggccgagggctaaccgtcggt
ttatatgaagcatctgattttgcttcagcaacttcatcggctagctcaaagctcattcat
ggaggcttacgatatttagaacattatgagtttcgcttagtttctgaagcattagccgaa
cgtgaagtgttattggctaaagcaccacacattgcaaaaccaatgcgttttcgtttaccc
catcgtccatttttacgccctgcatggatgatccgtgctggccttttcctttacgataat
ttgggtaaacgaaccacacttcctgctagccattcagttgatcttgctgcatccggttta
cttaaaagtgaaataacaaaaggttttgaatattcggattgttgggtcgatgatgctcgt
ttagttattttaaatgcgatagctgcagaaaaaaatggagctgaagttaaaaactattgc
cgagtagaaaaggcgattcgtgttgataatatttggcatgtaaccatttttgatgctcaa
acgaacgctcgctttgagcgtaaagctaaagccttggttaatgctgcaggaccatgggtg
aaacagttttttgatgatagtttagaagatgaatctcctcgtaatattcgtttagtaaaa
ggttcgcacatcgttgtgcctaaaattcatgatgaagagcaagcgtacatattacaaaat
aaagataatcgaattgtatttgttattccttatatggaagatttttcaattattggaact
accgatgttgaatataaaggtgacccaagaaaagtagccatttctgaagatgaagtgagt
tatcttattgacgttgtaaaccagcatttcgttgagcaaataaaacgtgatgatgttgtt
tggacttatagtggtgtgcgtcctttgtgcgatgatgaatcagattcacctcaagcgatt
actcgagattatacgttagaattagagcaggagttagaccaagctccattactctccatt
tttggcggcaaattaacgacctatcgtaagttaggtgaaactgcgatgaaaatgttgacc
ccatacttcactaagatggggacgccttggaccagaaacgttgcgttacccggtggagat
tttgattatcctcgacatcaactggtcgataatatctgtagtaaacatcaatggttggct
aaagaaacagtgacacgttatgttaatcaatttggaacattaacatggactttattagaa
ggcattgagtgtcaaactgatatgggagagttgtttgcccaaggcgtttatcaagtagaa
attgactatttaattcaacatgagtttgctaagaatgaagaagatgttttatggcgaaga
actaagcttggtttatatttaaatgatgaagaaaaagctacaatagcgtcgtatatcgaa
agtaatttaagtagactaaaataa

DBGET integrated database retrieval system