KEGG   Viruses: 14005229
Entry
14005229          CDS       T40000                                 

Gene name
F366_gp37
Definition
(RefSeq) Escherichia phage TL-2011c; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Oslovirus; Escherichia virus TL2011
Organism
vg  Viruses (Escherichia virus TL2011)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 14005229
NCBI-ProteinID: YP_007001457
RS: NC_019442
UniProt: G9L6J0
LinkDB
Position
NC_019442:25408..25677
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system