KEGG   Viruses: 2952726
Entry
2952726           CDS       T40000                                 

Gene name
grh110
Definition
(RefSeq) Macacine betaherpesvirus 3; rh110
  KO
K22779  Cytomegalovirus tegument protein pp71
Taxonomy
TAX:47929
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Macacine betaherpesvirus 3)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 2952726
NCBI-ProteinID: YP_068203
RS: NC_006150
UniProt: Q2FAK3 Q7TFM4
LinkDB
Position
NC_006150:complement(107776..109422)
AA seq 548 aa
MDRPPEEEEEPRPSTSRALAPAVTFERLTCQILRLVCTQHSPLDVDAVQTMNWHTSVEVA
NRAVICAFQEMKSSRDALQLTDLNLKGHCSSTFRDSLRTDACNYANRRLSPGSQTSAMLV
FALPIVRVPVTGIHLFRGRGNSQNRPPRANARTTIRRAQYTWTVKVNVSAITWTRKRDQY
VEGGYTFATDFTFLTGLIPLTLVDAIDQLACSNGDTYVQKVETIGEENLILVSLIHFSLH
PPTEVFLQLSVYAHRAEVMWRHNPNPFFERHSENGFLVKCPLHVTIPAHQTYVVQFNNAL
ETQDTCYAVFFPLELPGISMDAGPLPNRMKITINVQNLTANAITLAHMQMLGFIHLFRRG
SVGVLPNKTETPRCSQIRLRAGLFPRDSILRGISEFAQQPNNSSSSEDEEEEGPPITPPI
ITEAIFDPFQSEDSSDEDDEPQTTMDRLRREAHKAKREGTAAPVTHRERLPKTAMLLVVP
SWNMYIHPDLLMPLTARIAEEAVKNTSYLRSELDGDICTAADLKTTLQALAQVPGRRSPS
GRPQRPRI
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggatcgccctcccgaggaagaagaagagcccaggccgtctacctctcgagccctcgcc
ccggccgtcaccttcgaacgcctcacctgccaaatcctgcgcctcgtctgcacgcaacac
agcccgctggacgtcgatgccgtgcagacgatgaactggcacacctccgtggaggtggcc
aatcgggccgtcatctgcgcttttcaagaaatgaagtcctctcgcgacgcgttgcagctt
actgacctaaatctcaagggacattgcagttctacgttccgagactcgctgcgcacggac
gcgtgcaactacgccaaccggcgcctctcacccggctcgcagacatcggctatgctggtt
ttcgcgctccctatagtacgcgttcccgtgacaggcatccacctgttccgcggccgagga
aacagccagaatcggccgccgagagccaacgcccgcaccaccatccgtcgagcccagtat
acctggactgtgaaggtgaacgtgagcgctatcacgtggactcgtaaacgagaccagtac
gttgaaggcggttacacgtttgcgaccgacttcacgttcctcactggcctcatacctctc
accttagtagacgccatcgaccaactggcctgttccaacggtgacacgtatgttcagaaa
gtcgagaccataggcgaagagaatttgatcttagtgtcgctcatccatttctctctccac
ccacctacagaggtgtttttgcaattatctgtatacgctcaccgcgctgaggtgatgtgg
cgccataaccctaaccccttcttcgagagacactcagaaaacggctttctcgtgaaatgc
cccctgcacgtcactattcccgctcatcagacgtatgtggtgcaatttaacaacgcgctg
gaaactcaggacacctgttacgccgtattctttcccctggagctcccggggattagcatg
gacgcgggtcccctgcccaaccgcatgaaaattaccattaacgtgcagaatctgacagct
aacgcgataaccttggcccacatgcaaatgcttggatttatccacttatttcgccgaggc
tcggtcggcgtgttgcccaacaagaccgaaaccccgagatgctctcagatccgtcttcga
gccggcttgtttcccagggactccattttacgcggcatctccgaattcgcccagcaaccc
aacaattcgtcttccagcgaagacgaggaggaagaaggtcctccaattactcctcctatt
atcacggaggccatctttgacccctttcaatccgaagactcctcggatgaagacgatgag
ccgcagaccaccatggacagactccgaagagaagcccacaaagccaaacgagaaggcacc
gcggcgccggtgactcatcgtgagagattacccaaaacggccatgctgctagttgtacct
tcatggaatatgtatattcacccagatctgctaatgcccctgactgcccgaatagccgag
gaggcggtgaaaaatacttcgtatctccgaagtgaactggacggagatatttgcaccgcc
gccgacctcaaaaccacccttcaagccctagcacaagtccccggccgtcgctcccccagc
ggccgaccacaacgacctcgaatttaa

DBGET integrated database retrieval system