KEGG   Viruses: 3077462Help
Entry
3077462           CDS       T40000                                 

Gene name
UL37, HHV5wtgp042
Definition
(RefSeq) Human betaherpesvirus 5; envelope glycoprotein UL37
  KO
K22789  UL37 HCMV immediate early glycoprotein
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_UL37_2 AbfB FUSC Pes-10
Motif
Other DBs
NCBI-GeneID: 3077462
NCBI-ProteinID: YP_081496
RS: NC_006273
UniProt: Q6SW94 F5HI84
LinkDB All DBs
Structure
PDB: 

Position
NC_006273:complement(join(50262..51197,51302..51344,52573..53060))
AA seq 488 aa AA seqDB search
MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKACALTRRSRHRLRRQHGV
IDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEEREDEEEENEARTPEVNPMDAE
GLSGLAREACEALKKALRRHRFLWQRRRRARLLQHNGPQQSHHAAVFCRVHGLRGFQVSV
WLLLTLFWSTGYGVSVRCTYHGTDINVTSNATSMNCRLNCTCNHTQIYNGPCAGAESKLP
LNVTFRQSRRQWHSVMLTFGFQYHLEGWFPLRILNESRDINVTEVYGEVACFTNDTNITM
GQLTLNLTGRSYVLRALARTSPFESSVNWEETNVTDNATSSENNTVTVMSVLTVYAESDY
IFLQDMCPRFLKRSVKLAKNNRRNTTFTGTNVTSLPEWTLQQCQGWKYWTTLSIMWKNRR
SALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSST
KNDVHWIV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagtctacgtgaatctgttaggtagcgtgggcctgctggccttttggtacttt
agctaccgctggatccagcgaaaacgccttgaagatcctctcccgccttggttaagaaag
aaaaaagcatgtgcgctcacccggcgttctcggcaccggttacgccgccaacatggcgta
attgacggtgagaactcggagaccgagcggtccgtggacttggtggccgcgctcttggcc
gaggccggggaggagagcgtaacggaggacacagagcgggaggacacggaggaggaaagg
gaggatgaagaagaagaaaacgaggctcggacgcccgaggtgaaccccatggacgccgag
ggcctctcaggacttgcgcgagaagcctgcgaggctctcaaaaaggccctgcggaggcac
cggttcctgtggcaacggcggcgacgagctcggctgctgcagcacaacggcccccagcag
tctcaccatgccgcggttttttgtcgcgtccacgggctgcgcgggtttcaggtgtctgtg
tggctgttgttgacgctgttttggagcacgggatacggtgtttctgttcgatgtacgtac
cacggtacggacattaacgtcacttccaacgccacgagtatgaactgccggttaaactgc
acgtgcaatcatacgcaaatctacaacggcccctgcgccggagccgaatccaaactgccc
ttgaacgtaacgtttcggcaatcacgtcggcagtggcacagcgtcatgctcacgtttggt
tttcagtaccacctggaaggctggtttcccctgcgcatcctgaacgagagccgcgatatc
aacgtcaccgaggtctacggggaggttgcgtgttttacaaatgacactaacattaccatg
ggacagctgacgcttaaccttaccggccgcagttacgtattacgggcactggcgcgcacg
agtccgtttgagtcatccgtaaattgggaggaaaccaacgtcaccgacaacgcgacgtct
tcggaaaacaacaccgtcaccgtgatgtcagtcttaacggtatatgcggaaagtgattac
atttttctacaagacatgtgtccgcggtttcttaagaggagcgttaagcttgcgaaaaac
aacagaagaaacacaacttttacgggaactaacgtgacgtcgcttcccgagtggacacta
caacaatgccaggggtggaaatattggactacgttatccatcatgtggaaaaaccgccgt
tcggctctgctccgagccaaaagtcgcgcgttgggacactgggcgttgttgagcatatgt
actgtggcggcgggcagcatcgcgttgctcagcctcttctgcatcctcctcatcggactt
cgtcgcgatttgcttgaagatttccgctacatttgtcgggacgagggaagttccagcaca
aaaaacgacgttcattggatcgtctga

DBGET integrated database retrieval system