KEGG   Viruses: 3077555
Entry
3077555           CDS       T40000                                 

Gene name
US6, HHV5wtgp137
Definition
(RefSeq) Human betaherpesvirus 5; membrane glycoprotein US6
  KO
K22785  HCMV membrane glycoprotein US6
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: US6
Other DBs
NCBI-GeneID: 3077555
NCBI-ProteinID: YP_081591
RS: NC_006273
UniProt: Q6SW00 F5HG05
LinkDB
Position
NC_006273:complement(201615..202163)
AA seq 182 aa
MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQACVPRTKSHRPVCYNDTGDCTDAD
DSWKQLGEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLTCQRVRRLLPCDLDIHPSHRLL
TLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLVVILALLCSITYESTGRGIRRC
GS
NT seq 549 nt   +upstreamnt  +downstreamnt
atggacctcttgatccgtctcggttttctgttgatgtgtgcgttgccgacccccggtgag
cggtcttcgcgtgacccgaaaacccttctctctctgtctccgcgacaagcttgtgttccg
agaacaaagtcgcacagacccgtttgttacaacgatacaggggactgcacagatgcagat
gatagctggaaacagctgggtgaggactttgcgcaccaatgcttgcaggcggcgaaaaag
aggcctaaaacgcacaaatcccgtccgaacgataggaaccttgagggtaggctgacctgt
caacgagtccgtcggctactgccctgtgatttggatattcatcctagccaccggttgtta
acgcttatgaataactgcgtctgtgacggggccgtttggaacgcgtttcgcttgatagaa
cgacacggattcttcgctgtgactttgtatttatgttgcgggattaccctgctggttgtt
attctagcattgctgtgcagcataacatacgaatcgactggacgtgggattcgacgttgt
ggctcctga

DBGET integrated database retrieval system