KEGG   Viruses: 3293809
Entry
3293809           CDS       T40000                                 

Gene name
MuHV1_gp049
Definition
(RefSeq) Murid betaherpesvirus 1; viral inhibitor of RIP activation
  KO
K12970  Murid betaherpesvirus 1 ribonucleoside-diphosphate reductase [EC:1.17.4.1]
Taxonomy
TAX:10366
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Muromegalovirus
Organism
vg  Viruses (Murid betaherpesvirus 1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN RHIM LANC_like
Other DBs
NCBI-GeneID: 3293809
NCBI-ProteinID: YP_214057
RS: NC_004065
LinkDB
Position
NC_004065:complement(join(59515..62145,62769..62876))
AA seq 912 aa
MNGVSGIQIGNHNAMSIASCWSPSYTDRRRRSYPKTIRILTCRFGTTSSSSDGDRGRRRR
SVVFLVRERRRPRRIRRSAHRRAPRQGRDAPPDPDDDGHSRQQALPRGARQRRDALFDDA
VESVRCYCHGILGNSRFCALVNEKCSEPAKERMARIRRYAADVTRCGPLALYTAIVSSAN
RLIQTDPSCDLDLAECYVETASKRNAVPLSAFYRDCDRLRDAVAAFFKTYGMVVDAMAQR
ITERVGPALGRGLYSTVVMMDRCGNSFQGREETPISVFARVAAALAVECEVDGGVSYKIL
SSKPVDAAQAFDAFLSALCSFAIIPSPRVLAYAGFGGSNPIFDAVSYRAQFYSAESTING
TLHDICDMVTNGLSVSVSAADLGGDIVASLHILGQQCKALRPYARFKTVLRIYFDIWSVD
ALKIFSFILDVGREYEGLMAFAVNTPRIFWDRYLDSSGDKMWLMFARREAAALCGLDLKS
FRNVYEKMERDGRSAITVSPWWAVCQLDACVARGNTAVVFPHNVKSMIPENIGRPAVCGP
GVSVVSGGFVGCTPIHELCINLENCVLEGAAVESSVDVVLGLGCRFSFKALESLVRDAVV
LGNLLIDMTVRTNAYGAGKLLTLYRDLHIGVVGFHAVMNRLGQKFADMESYDLNQRIAEF
IYYTAVRASVDLCMAGADPFPKFPKSLYAAGRFYPDLFDDDERGPRRMTKEFLEKLREDV
VKHGIRNASFITGCSADEAANLAGTTPGFWPRRDNVFLEQTPLMMTPTKDQMLDECVRSV
KIEPHRLHEEDLSCLGENRPVELPVLNSRLRQISKESATVAVRRGRSAPFYDDSDDEDEV
ACSETGWTVSTDAVIKMCVDRQPFVDHAQSLPVAIGFGGSSVELARHLRRGNALGLSVGV
YKCSMPPSVNYR
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgaatggagtctctggaatacagatcggaaaccataatgctatgagcatcgcctcttgc
tggagtccctcctacactgaccgacgccgcaggagctaccccaagaccatccgaatcctc
acctgccgcttcggcaccaccagcagcagcagcgatggcgaccgggggagacgacgaaga
tcagtcgtctttctcgttcgtgagcgacgacgtcctcggagaattcgaagatctgcgcat
cgccgggctccccgtcagggacgagatgcgccccccgaccccgacgatgacggtcattcc
cgtcagcaggcccttccgcgcggggcgcgacagcggcgcgacgccttgtttgacgacgcc
gtcgagtccgtgcgctgctactgccacggcatcctcggcaacagccgattctgcgccctc
gtcaacgagaagtgctccgaacccgccaaggagcgcatggctcgcatccgccgctacgcc
gcggacgtgacgcgctgcggacccctcgcgctctacaccgccatcgtctccagcgccaac
cgtctcatccagaccgacccgtcgtgcgacctggatctcgccgaatgttacgtcgagacg
gcgtccaagaggaacgccgtccccctctcggccttctaccgcgactgcgatcgcctgcgg
gatgctgtcgccgcgttcttcaagacctacggcatggtggtggacgccatggcgcagcgc
atcacggagcgggtcgggccggccctgggtaggggcctctactcgaccgtcgtcatgatg
gatcgctgcggaaacagcttccagggacgcgaggagacccccatctccgtcttcgcccgg
gtcgccgcggctctcgccgtcgagtgcgaggtcgacgggggcgtctcgtacaagatcctc
agctccaagcccgtcgacgccgcgcaggccttcgacgccttcctctccgccctctgctcc
ttcgccatcatcccctcgccgcgggtcctggcctacgccgggttcggcggttccaacccg
atcttcgacgccgtttcttaccgcgctcagttctactcggccgagagcacgatcaacggc
accctgcacgacatctgcgacatggtgaccaacggcctctcggtgtccgtcagcgcggcg
gacctcggaggcgacatcgtggcctctctgcacatcctcggacagcagtgcaaggcgctg
cggccgtacgcgcgattcaagaccgtcttgaggatctacttcgacatctggtccgtcgac
gctctcaagatcttctctttcatcctcgacgtcgggcgggaatacgagggcctgatggcc
ttcgcggtcaacacgccgaggatcttctgggatcgctacctagacagctccggcgacaag
atgtggctcatgttcgcgaggcgggaggccgcggccctgtgcggcctcgacctcaagtcc
ttccgtaacgtctacgagaagatggagcgtgacgggcgcagcgccatcaccgtctcgccc
tggtgggccgtctgtcagctcgacgcgtgcgtggcgcggggcaacacggccgtggtcttc
cctcacaacgtcaagagtatgatccccgagaacatcgggcgccccgccgtgtgcggaccc
ggcgtctccgtcgtctccggcggcttcgtcggctgtacccccatccacgagctgtgcatc
aacctggagaactgcgtcctggagggcgcggcagtcgagagctccgtcgacgtggtcctc
ggtctcggttgccgcttcagcttcaaggccctggagtccctggtccgcgacgcggtggtg
ctgggtaacctgctcatcgacatgaccgtgcgcaccaacgcgtacggcgccggcaagctc
ctgacgctctatcgcgacctgcacatcggggtcgtcggcttccacgctgtgatgaatcgc
ctcgggcagaagttcgccgacatggagtcttacgacctcaaccagcgtatcgcggagttt
atctactacaccgccgtgcgggccagcgtcgacctgtgcatggcgggcgccgatccgttc
cccaagttccctaagagcctgtacgcggccggccgcttctaccccgacctcttcgacgac
gacgagcgcggcccgcgtcgcatgaccaaggagttcctcgagaaactacgtgaagacgtg
gtgaaacacggcatcaggaacgcctccttcatcaccggctgctcggccgacgaagccgcc
aacctggcgggcaccactccgggcttctggccgcgccgcgacaacgtctttctcgagcag
acgccgctcatgatgaccccgacgaaggatcagatgctcgatgagtgcgtgcgctccgtc
aagatcgagccccatcgcctgcacgaggaggatctctcctgtctcggcgagaaccggccc
gtcgagctgcccgtgctcaacagccgcctcaggcagatctcgaaagagtccgcgacggtc
gccgtgcgccgcggccgctcggcgcccttctacgacgactcggacgacgaggacgaggtg
gcgtgctccgagaccggctggaccgtgtcgaccgacgcggtcatcaagatgtgcgtcgac
agacagccgttcgtcgaccatgcgcagtcgctgcccgtcgccatcggcttcggggggtct
tcggtggaattggcgcgtcatctgagacgagggaacgctctgggactgtccgtcggagta
tataaatgtagtatgcccccttccgtgaattatcgctga

DBGET integrated database retrieval system