KEGG   Viruses: 935483
Entry
935483            CDS       T40000                                 

Gene name
US11, CCMVgp142
Definition
(RefSeq) Panine betaherpesvirus 2; membrane glycoprotein US11
  KO
K22786  HCMV membrane glycoprotein US11
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: CMV_US
Other DBs
NCBI-GeneID: 935483
NCBI-ProteinID: NP_612784
RS: NC_003521
UniProt: Q8QRU8
LinkDB
Position
NC_003521:complement(211467..212144)
AA seq 225 aa
MRLGLLWITLCSAVRGEDVCPRSWSLPYANETVPRTAKKTTTDTVPGFPPWPDISGYAVE
HSGVQCVIRHGGKLEALWILRGNFSAKGPVPKAYYRYDGGVSEDIPLQDVSGDTAASVRR
YWLYGYPVRVDLRRVFFYFQPCYRCHAHWTECEPAAAVPWLPLWSSFHDVRRLLHESRRL
TAYYVMFVKSFQYTLMCVMAIQVFWGTCVQTWPYHDRPWLIWDHM
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaggctgggactgctctggatcaccctgtgtagcgcggtccggggggaggatgtctgt
ccgcgatcgtggtcgctgccgtacgcgaacgagacggtcccccggaccgcaaaaaaaacg
acgacggacacggttccgggctttcctccctggccggacatctcgggctacgcagtggag
cactctggcgtccagtgcgtgatccgccacggcggcaagctggaggccctgtggatcctc
cgcggcaacttctccgccaaaggcccggtaccgaaggcgtactatcggtacgacggcggt
gtcagcgaagacatcccgctgcaggacgtctccggggacaccgccgcgagcgtgcggcgc
tactggctgtacggttatcccgtgcgtgtcgacctacggcgcgtattcttttattttcag
ccctgttaccgctgccacgcgcactggacggagtgcgaacccgcggccgcggtaccctgg
ttgcccctgtggagctcgtttcacgatgtgcgccggctgctgcacgagagccggcgcctg
acggcctactacgtgatgttcgtgaagtcgtttcagtacacgctgatgtgtgtgatggcg
atccaggtgttttggggaacgtgcgtgcagacttggccgtaccacgataggccgtggctc
atctgggaccacatgtga

DBGET integrated database retrieval system