KEGG   Virgibacillus sp. SK37: X953_14010
Entry
X953_14010        CDS       T03219                                 

Gene name
uvrA
Definition
(GenBank) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
vir  Virgibacillus sp. SK37
Pathway
vir03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:vir00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    X953_14010 (uvrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vir03400]
    X953_14010 (uvrA)
DNA repair and recombination proteins [BR:vir03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     X953_14010 (uvrA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      X953_14010 (uvrA)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_29 AAA_21 AAA_33 AAA_14 AAA_22 AAA_23 BCA_ABC_TP_C AAA_18 DnaJ_CXXCXGXG APS_kinase ATPase ATPase_2 cobW Viral_helicase1 NACHT DUF2075 AAA_25 Septin AAA_24 NB-ARC T2SSE
Other DBs
NCBI-ProteinID: AIF44140
UniProt: A0A075JRD0
LinkDB
Position
complement(2596425..2599301)
AA seq 958 aa
MPSKSIQIQGARAHNLKDIDVTIPKNNLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDAIEGLSPAISIDQKTTSKNPRSTVGTVTEIYDYLRLLYARVGHP
TCPKHGIEISSQTVQQMVDRILEYPERTKLQILAPVVSGRKGEHVKVFEKLRQEGYVRIR
VDKEMREVSEEIKLEKNKKHSIEVVVDRIVVKDGITGRLSDSIETALALGEGKIIVDVIG
EEELMFSENHACPICGFSIDDLEPRLFSFNSPFGACPTCDGLGTNLEVDLDLVIPDWDKT
LNEHAIAPWEPISSQYYPQLLQSVCIHFNINMDTPVKDLPKEQMDKILYGGGNEKVHFHY
VNDFGKVRDNHVAFEGVLANVARRYRETSSDFIRETLEKYMAQKHCPACKGYRLKEEALA
VLVNGLHISKVTDFSIVEAQNFFEQLELSEKEEKIAQMILKEICNRLEFLNNVGLDYLTL
SRAAGTLSGGEAQRIRLATQIGSALTGVLYVLDEPSIGLHQRDNDRLIETLKRMRDLDNT
LIVVEHDEDTMLAADWLIDIGPGAGEHGGQIVSSGTPSEVMKDERSLTGQYLSGDKFIQL
PSQRRKSDKRFIEVVRAEENNLKKVNAKFPIGLMTVVTGVSGSGKSTLVNEILYKSLAKE
LYRGKHKAGKHKTVKGIEHIEKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
VRGYKKGRFSFNVKGGRCEACRGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVKYKG
KNISDVLGLTIEESLEFFANIPKIKRKLQTIYDVGLGYIKLGQPATTLSGGEAQRVKLAS
ELHRRSNGKSFYILDEPTTGLHVDDIKRLLAVLQRLVDNGDTVLIIEHNLDVIKTADHII
DLGPEGGARGGQIIATGTPEEIAKKEVSYTGRYLKPVLERDQQRMNKLISNKEKISTK
NT seq 2877 nt   +upstreamnt  +downstreamnt
atgcctagtaaaagcatacaaattcaaggcgcaagggcacataatttaaaagatattgat
gtcaccatacctaaaaataacctagtcgtacttacaggtttgtctggatcgggaaaatct
tcactcgcttttgatacaatttatgcagaagggcagcggcgctatgtcgagtctctttct
gcttatgcacgacaatttttgggacagatggataagccggatgtagatgctatagaggga
ctgtcccctgctatttctattgaccagaagactacgagtaagaatccaaggtctacagta
ggaacagtgacagaaatctatgattatttaagacttctatatgccagggtgggacatccc
acttgtccaaaacatggaattgaaatttcctcccaaacggtccagcaaatggttgatcgc
attttggaatatcctgaacgcacgaagcttcaaatacttgcgcctgtcgtttccggcaga
aaaggtgagcatgtaaaagtgtttgagaaattgcgtcaggaaggttatgtaagaataaga
gttgacaaggaaatgcgagaagtatcggaagaaattaaattagagaaaaacaaaaagcat
tctattgaagttgtggtagaccgtattgtagttaaagatggaattactggccgtttgagt
gattctattgaaactgcacttgctttgggcgaaggcaagatcattgttgacgtaataggt
gaagaagaattaatgtttagtgaaaatcatgcatgtccaatatgtggattctctattgat
gacttggaaccaagattattttctttcaatagtccatttggagcatgcccgacatgtgac
ggacttgggacgaacctggaagtagacttggatctggttattcctgattgggataagacg
ttaaacgagcatgcgattgccccttgggagccaattagttcacagtactatcctcagttg
ttacaaagtgtttgcattcattttaatattaatatggatacaccagtaaaagaccttcca
aaagaacaaatggataaaattttatatggaggcggaaatgaaaaagtccattttcattac
gtaaatgattttggcaaagtcagagataaccatgtggcttttgaaggggtattagcaaat
gtagccagacggtatcgggaaacttcatctgacttcattcgtgaaaccttagaaaagtac
atggcccagaaacattgtcctgcatgtaagggataccgtttaaaagaagaagctttagca
gttctggtaaatggtcttcatataagcaaagtcactgatttttccatcgtagaggctcag
aacttttttgaacaattagagctaagtgagaaggaagaaaaaattgctcaaatgatcctc
aaggaaatttgtaaccgactggaatttttaaataatgtcggattggattatcttacttta
tcccgtgcagctggtacactctcgggcggggaagcccagcgtatacgcctggctactcag
attgggtctgcattgacaggggtcctttacgtattggatgagccatccatcggactccat
caacgggataatgatcgccttattgaaacattaaaacgtatgagggatttggataatacc
ttaattgttgtggagcacgatgaagataccatgctggcagccgattggttaattgatatt
gggccaggagctggggagcatggtggtcaaatagtttcaagtggcacgccatcagaggta
atgaaagatgagcgttctctaacaggtcaatatttatctggagataaatttattcaacta
ccatctcaaagaagaaaaagcgacaaacgttttattgaagtagttagagcggaagagaat
aatttaaaaaaggttaatgctaagtttccaattggtttaatgacggtagttaccggggtt
tctggttcaggtaaaagtactttagtaaatgaaatcttatataaatcactagccaaggaa
ttgtatcgtggtaaacataaggcaggaaagcataaaacggtaaaagggattgagcatatc
gagaaggttatcgatattgaccaatcaccgattgggcgtacacctcgttccaacccagca
acttatactggtgtttttgatgatattcgtgatgtatttgctcaaactaacgaagcaaag
gtacgaggctacaaaaaaggtcgtttcagttttaatgttaaaggtggaagatgtgaagct
tgtcgtggcgatggcattattaaaattgaaatgcacttcttgccagatgtatatgttcct
tgtgaggtttgtcatgggaaacgatacaatcgggaaaccttggaggttaaatataaagga
aagaatatctcagatgtattagggcttaccattgaagagtccttggagtttttcgctaac
atccctaaaattaaacgtaaattgcaaactatttatgatgtaggtttaggatatatcaaa
ctaggacaaccagcaactacattgtcgggcggagaggcgcaacgggtgaagcttgctagt
gaattacaccgccgttccaatggaaaatctttttatattttagacgaaccaaccactggt
ttacatgttgatgatatcaagcgtttgttagctgtgcttcagcgtctagtagataatgga
gataccgtactaattattgaacacaatcttgatgtgatcaaaactgcagatcatatcatt
gacttaggaccagaaggcggagcacgtggaggacagattattgcaacaggcacgccagaa
gagattgcaaaaaaagaagtttcttatactgggcggtatttaaaaccagttttagaacga
gatcagcagcgaatgaacaagctgatttcaaacaaagaaaaaataagtacaaaataa

DBGET integrated database retrieval system