KEGG   Vibrio mimicus: AL543_04265Help
Entry
AL543_04265       CDS       T04381                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vmi  Vibrio mimicus
Pathway
vmi00473  D-Alanine metabolism
vmi00550  Peptidoglycan biosynthesis
vmi01100  Metabolic pathways
vmi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL543_04265
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL543_04265
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AL543_04265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vmi01011]
    AL543_04265
Enzymes [BR:vmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AL543_04265
Peptidoglycan biosynthesis and degradation proteins [BR:vmi01011]
 Precursor biosynthesis
  Amino acid ligase
   AL543_04265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AMG02240
LinkDB All DBs
Position
1:954348..955352
Genome map
AA seq 334 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFNVVRVEMKKEGWFSKHGELVYLD
TNSATLNGDNISYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALGIPNTPYLFLTQNTSDSVEKARQAFRNWGSIFVKAARQGSSVGCYKVTSEEQI
VAAIEAAFGFSEQVLVEKAVKPRELEVAAYEMNGKLFISKPGEIIAPEDAFYSYEEKYSA
TSHSRTLIEAENLTDEQRELIQQSAERVFVHMKLRHLSRIDFFLTQDDHIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLAQCVISTLASAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactaagactacaatcctacttttatgtggtggcggctcatctgagcacgaaatttca
ctcgtatcagcaaactacatccagcagcaacttgaacttacacctgaattcaatgtagtt
cgtgttgagatgaaaaaagaaggctggttttctaagcatggtgaactggtttatctagat
accaacagtgcgacgttaaatggcgataatatctcttatccaattgattttgtggtgcct
tgtatccatggttttcctggtgaaacaggggatattcagtccatgcttgaacttgccggc
attccatacctaggttgtgggccagaagcgagtgcgaacagctttaataaaatcacatcc
aaactgtggtatgacgcactgggtattccaaacacgccatatctattcttgactcaaaac
acttcagactcggttgaaaaagctagacaggccttccgcaactgggggagcatctttgtt
aaagctgcacgtcaaggctcttccgtaggatgttacaaggtaaccagtgaagaacaaatt
gttgctgcaattgaggctgcgtttggtttttctgagcaagtattagtggaaaaagccgtc
aagccaagagagcttgaggttgcagcttatgaaatgaatgggaaattgtttatttccaaa
ccaggtgagattattgctcctgaagatgctttctattcttatgaagagaaatacagtgca
acaagccattctcgtacactcattgaagctgaaaatttgactgatgagcaacgtgaactc
atccagcaaagtgcggagcgtgtttttgttcatatgaagcttcgtcatctgtctcgcatt
gatttcttcctaactcaagacgatcacatttatctcaatgaagtcaatacattcccagga
atgacgccaatttccatgttccctaaaatgctggagcataacggacatcgctttagcgag
tttttagctcaatgtgttatcagcacattagccagtgcaaagtag

DBGET integrated database retrieval system