KEGG   Vibrio nigripulchritudo: VIBNI_A0121
Entry
VIBNI_A0121       CDS       T02871                                 

Definition
(GenBank) putative GGDEF domain and PAS/PAC domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vni00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VIBNI_A0121
Enzymes [BR:vni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VIBNI_A0121
SSDB
Motif
Pfam: GGDEF PAS_8 PAS HAMP
Other DBs
NCBI-ProteinID: CCO56331
UniProt: U4K1C9
LinkDB
Position
1:111829..113427
AA seq 532 aa
MNKQALANRLLVTVVIFSLMYLVLAASFLTLFYFERASLNVRDMEEKLVLTVSNSASIAL
YVDNPEIADEVMSSLLLHDEFNGVKLKGIDGIEFSLSKLTSNREQWQNLERFPLVSPVKD
EVIGHLILDVNQEYLDSVTQEKVFIQLVMLISQLLMLLIVTAFAVRKVIGFPLQKLAENL
SKVEPGKDELLPYNNENRDNEIGLVTASVNRFVEASHQAIETERNLRATIERMERHYRHI
FETTQVGILVLDKNGHLIHSNPTLFGRLIKESFELTAILETQPFFEHVFQNPELAWQMSE
QTISSGDMASGDLRINKRYSADQWVHLLLSAHKDEHSGEWLIEGIMYDITVRVQKERDTL
LLALEDNLTGLKNRRGCERFVATLASQKKAAYIATMMLDLDGFKDVNDTHGHAAGDEVLC
TIARRLKRVARGGQDVIGRIGGDELLVILALEQINPDVLAGIAEQIVEICARPIELPSRS
TVRIGGSVGVAYAGVNDIEFDALLQQADEAMYKVKENGKNGYAFYNPELRRA
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgaataaacaagcgcttgctaatcggcttttagttaccgttgtcatattctcgctcatg
tacctggtattggcagcgagttttttgactctgttctattttgagagagccagtctgaat
gttcgtgatatggaagagaaattggtcctgacggtatccaactctgcttctatcgccttg
tatgtcgataaccctgaaattgcagacgaagtcatgagctcgttgcttcttcacgatgaa
ttcaatggggtaaaactcaaaggaatcgatggtattgagtttagcttgtcaaagctcacc
agtaatcgagagcaatggcagaacctggaacgatttccgctggtttctccggtgaaagat
gaagtgattggtcatctgattctggatgtgaatcaggagtatctggattcggtcactcag
gagaaagttttcatccagctagtgatgctgattagtcagttgctgatgctgctgattgtg
acggcctttgcggttcgaaaagtcattggttttccgcttcagaaactcgctgaaaacctg
tctaaagtggagccaggtaaagatgagttacttccttataataacgaaaaccgcgacaac
gaaattgggttggttaccgccagcgtaaaccgttttgttgaagcctctcatcaggcaata
gaaaccgagcgcaacctcagagccactatcgaacgcatggagcgtcattatcgacatata
ttcgaaaccactcaggttggaattctggttctcgataaaaatgggcatttaattcacagt
aacccaacgctgtttggccgattaatcaaagagagttttgagctgacggctattcttgaa
actcagccattttttgaacacgtttttcagaacccagaactcgcgtggcaaatgtcagag
cagaccatatccagtggtgatatggcgtcgggtgatttgcgtattaacaaacgctacagc
gcggaccaatgggtgcacctactgctctcggctcataaggatgagcacagtggggaatgg
ctcattgagggcattatgtatgacatcacggtgcgagtgcagaaagagagagacactttg
ctgcttgcgttagaagataatctgacaggtctcaaaaaccgtcgaggatgcgaacgattc
gttgccactctcgcaagtcagaaaaaagccgcatacatcgcgaccatgatgctggattta
gatggcttcaaggatgttaatgatactcatggacatgcggcaggggacgaggtgctttgc
accattgccaggcgcttgaagagagtcgcgcgtggcgggcaggatgtcattgggcggata
gggggcgatgaacttttggtgattctcgccttggagcagatcaatccggatgtactggca
ggcattgccgaacagattgtagagatctgcgccagaccgattgagctgccttcccgttca
actgttcggatcggcggcagcgtaggtgttgcctacgctggagtgaatgatattgaattt
gatgccttacttcagcaagctgacgaagccatgtataaggttaaggaaaacggcaaaaac
ggctatgcgttttataacccggagcttcgccgcgcttag

DBGET integrated database retrieval system