KEGG   Vibrio nigripulchritudo: VIBNI_A0149
Entry
VIBNI_A0149       CDS       T02871                                 

Gene name
alaS
Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vni00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VIBNI_A0149 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vni01007]
    VIBNI_A0149 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vni03016]
    VIBNI_A0149 (alaS)
Enzymes [BR:vni01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     VIBNI_A0149 (alaS)
Amino acid related enzymes [BR:vni01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   VIBNI_A0149 (alaS)
Transfer RNA biogenesis [BR:vni03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    VIBNI_A0149 (alaS)
 Prokaryotic type
    VIBNI_A0149 (alaS)
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD DMPK_coil BAT FANCAA Fungal_TACC Flagellar_rod
Other DBs
NCBI-ProteinID: CCO56356
UniProt: U4K1E9
LinkDB
Position
1:146372..148954
AA seq 860 aa
MYMSTDEVRNAFLKFFESKGHQIVDSSSLVPHNDPTLLFTNAGMNQFKDCFLGLEKRAYT
RATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKEDAISFAWEFLTEVLQ
LPKDRLLVTVYETDDEAFDIWNKKVGVPADRIVRIGDKEGGKPYESDNFWQMGDTGPCGP
CTEIFYDHGDHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRHADGTMEPLPKPSVDTGMGI
ERISAIMQGVHSNYEIDVFQTLIKAAAEVTGHEDLSNQSLRVVADHIRSCAFLIVDGVMP
SNEGRGYVLRRIIRRAVRHGNKLGAQGAFFHKLVGVLAEVMGTAGVELKKQQALVEKVLR
IEEENFGRTLERGMSILNEALDGLDGKVLDGETVFKLYDTYGFPADLTNDVARERDFAID
EEGFEKAMEAQRQRAREAGQFGTDYNAAIKVDASTEFCGYTGTEGSSTVSALFVEGNEVE
ALSAGDKAIVILEETPFYGESGGQCGDTGTLKTDAGLFQVEDTQKLNNAIAHHGVLVEGV
FAKGDSVAATVDAARRAAIILNHSATHLLHAALRHVLGDHVAQKGSLVKAEGLRFDFSHL
EAMTPAEIKEVERLVNIHVRRNHNIQTDIMNIEDAKAKGAMALFGEKYDDQVRVLTMGEF
STELCGGIHASSTGDIGLFKITSEGGIAAGIRRIEAVTGEGALDAIEAENSKYEEKLSEA
ASKAKALEKEIQQLKDKLASQASASLTSQVKEIAGVKVLVSKLDGADNKALRGMVDELKN
QLGSGIIMLGNVAGDKVGLIAGVTKDLTGKVKAGELVNMVAQQVGGKGGGRPDMAQAGGT
DANALPAALDSVDAWLEERL
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgtacatgagcacagatgaggttcgtaacgcgttcctcaagttctttgaaagcaaagga
caccaaatcgtagacagttcatcgttagtaccacataacgatccaaccctgctatttact
aacgcaggtatgaaccaatttaaagattgtttcttaggcttagaaaaacgagcctacact
cgagcgactacggcccaacgctgtgtacgtgctggcggtaagcacaatgaccttgaaaac
gtgggttttacagctcgccaccataccttcttcgaaatgttgggtaacttcagcttcggt
gattacttcaaagaagacgcgatctcgtttgcctgggaatttctgacagaagttcttcaa
cttccgaaagaccgtctgttggtgactgtttatgaaaccgacgatgaagcttttgatatc
tggaacaaaaaagtaggtgttccagctgatcgtattgttcgcatcggcgacaaagaaggc
ggtaagccatacgagtcagacaatttctggcaaatgggtgacacaggtccatgtggtcca
tgtactgaaatcttctacgatcacggcgatcacatctggggcggtcgtccgggcacacca
gaagaagacggtgaccgttttatcgagatttggaacaacgtattcatgcaatttaaccgt
catgccgatggcacgatggaaccgctaccaaaaccatcggtagacacgggcatgggtatc
gagcgtatttctgccatcatgcagggcgtgcattccaactacgaaatcgatgttttccaa
acgctgattaaagctgctgctgaggtgactggtcacgaagacctgtctaaccaatcgctc
cgcgtagttgctgaccacatccgttcatgtgcgttcctgatcgttgatggtgtaatgccg
tcaaacgaaggtcgtggctacgtacttcgccgtattatccgccgtgctgttcgccacggt
aataagttgggagcacaaggtgcgttcttccacaagctggttggtgtactggcagaggtg
atgggcacggcgggtgttgaacttaagaagcaacaagcactggttgaaaaagtacttcgc
attgaagaagagaactttggtcgcacgctagagcgtggcatgtctatcctaaacgaagcg
ttagatggtttggacggcaaagtacttgatggcgaaacagtattcaaactttacgatacc
tatggcttcccagcagatttaaccaacgacgtagcgcgtgagcgtgactttgctatcgac
gaagaaggcttcgagaaagcaatggaagctcagcgtcagcgtgcacgtgaagcaggtcag
tttggtacagactacaatgctgccatcaaagtggatgcgtctaccgagttctgtggatac
acaggcaccgaaggcagcagcacagtgtcggcactgttcgttgaaggtaacgaagtcgaa
gcattgtccgcgggcgacaaagccatcgtgattcttgaagaaacaccattttatggtgag
tcaggtggtcagtgtggtgacacaggtacattgaaaactgacgctggtcttttccaggtt
gaagatactcaaaagctaaacaacgcaattgcgcaccatggtgtgttggttgaaggtgtt
tttgccaaaggtgatagcgttgcagcaactgttgatgctgcgcgtcgtgcagcgatcatt
ctaaaccactcagcgactcacctactgcacgcggcgcttcgccatgtactgggtgatcac
gtggctcagaaaggctcacttgtaaaagctgaaggtctacgatttgacttctctcatctt
gaagcaatgacacctgcagaaatcaaagaagttgagcgtttggtaaacattcacgttcgc
cgtaaccataatatccagacagacatcatgaacatcgaagacgcaaaagcgaaaggtgcg
atggctctgttcggtgaaaaatacgacgaccaagtgcgtgttcttaccatgggtgaattc
tcaaccgaattgtgtggcggtattcacgcctcaagcacgggtgatattggcctattcaag
ataacctcagaaggtggtatcgcagcaggtattcgacgtattgaagctgtgacaggtgaa
ggtgcgctggacgctatcgaagccgaaaatagcaaatacgaagagaagctttctgaagca
gcaagcaaagcgaaagctcttgagaaagagattcaacagctaaaagacaagttggcatct
caggctagtgcaagcctgactagtcaggtaaaagaaattgctggcgtgaaagtacttgtg
tctaagctggacggcgcagacaacaaagcactacgcggcatggttgacgagcttaagaat
cagcttggtagcggtatcatcatgctaggtaatgttgctggcgacaaagttggtctgatc
gcaggcgtgaccaaagatctgacaggcaaagtgaaagccggcgaactggtcaacatggtt
gctcaacaagttggtggtaaaggcggtggtcgtcctgatatggcgcaagccggtggtact
gatgccaatgcacttccagcagcgctagactcagttgatgcctggctagaagagcgtttg
taa

DBGET integrated database retrieval system