KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0886Help
Entry
VPA0886           CDS       T00120                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00473  D-Alanine metabolism
vpa00550  Peptidoglycan biosynthesis
vpa01100  Metabolic pathways
vpa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VPA0886 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VPA0886 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VPA0886 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpa01011]
    VPA0886 (ddl)
Enzymes [BR:vpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VPA0886 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:vpa01011]
 Precursor biosynthesis
  Amino acid ligase
   VPA0886 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST Peptidase_M55
Motif
Other DBs
NCBI-GeneID: 1191575
NCBI-ProteinID: NP_800396
UniProt: Q87HS0
LinkDB All DBs
Position
II:931443..932432
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIQNVKVTRVEIKNEGWVTDQGELVYLDL
NTKQLCSNESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDALDIPNTPYLFLTRNDEHAHRQAEQAFEKWGKVFVKAARQGSSVGCYSVAEKQAIA
KAVNDAFGYSDQVLVEKAVKPRELEVAAYEMNGELHITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTQEQIDKIRHASETVFKQMNLRHLSRIDFFLTEDNEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttctattatgcggcggcggctcttctgaacacgaaatttcactg
ttgtcggctaactttgttgaacaacaactaaacctaattcagaacgtcaaagtcactcgc
gtagaaataaaaaatgaaggttgggttacagatcaaggcgaattggtttaccttgattta
aacaccaaacaattgtgctcgaatgagtccaatcaaacgatcgactttattgtgccttgt
attcacggctttcccggcgagactggtgacattcaatcactattcgaaattgccggtatc
ccatacttaggatgtggaccagaagcaagcagcaacagtttcaataaaatcacatcaaaa
ctttggtacgacgctttagacattccaaatacaccttacttattcctaactcgcaatgat
gaacacgctcacagacaagctgaacaagcctttgaaaagtggggaaaagtgtttgttaaa
gctgcacgtcagggctcgtctgttgggtgttacagtgtagcggaaaaacaagctatcgct
aaagcagtaaacgatgcgtttggttattcagatcaagtacttgtagagaaagcggtaaaa
cctcgtgagttagaagtcgcagcttatgaaatgaacggtgaactgcacatcactaagcca
ggtgaagtgatcgcacccgatggtgcattttactcatacgatgaaaaatacagcagttca
agccattcattaacagaagtagaagcgaagaacctgactcaagaacagatcgataagatt
cgtcatgcgtcagaaaccgtattcaaacaaatgaaccttcgtcatttgtctcgcatcgac
tttttccttacggaagataacgaaatttacttgaatgaagtgaatacattcccaggaatg
acgccaatttcaatgttccctaaaatgcttcaaaacaatggtcacaagttccatgagttt
cttgaagattgtattaatagtgcaaagtga

DBGET integrated database retrieval system