KEGG   Variovorax paradoxus B4: VAPA_1c18990Help
Entry
VAPA_1c18990      CDS       T02835                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, subunit F AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vpd  Variovorax paradoxus B4
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VAPA_1c18990 (ahpF)
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VAPA_1c18990 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored Glutaredoxin FAD_binding_2 FAD_binding_3 HI0933_like AlaDh_PNT_C DAO FMO-like K_oxygenase Thi4 Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGU49005
UniProt: T1XA13
LinkDB All DBs
Position
1:2026844..2028415
Genome map
AA seq 523 aa AA seqDB search
MLDASTKAQLKSYLERATQPIEIVASLDDSKASGEMLSLLKDVAEASPLVKLTESRDDNH
RKPSFSVNRPSENHGPRFAGLPMGHEFTSLILALLQVGGYPPKVEQAVLDQIRALDGDFE
FEIYVSLTCHNCPDVVQALNLMAIQNPRIRTTMIEGGTFQDEVKERQVMAVPTVFLNGTE
FGQGRMSLEEILAKIDTSGVEREAKKIAAKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTLGIENFISIKETEGPKFAHALEEHVRDYDVDIMNLQRAKALVPGKDLI
EVQLESGASLKSKSIIISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLIEFDTALRADAVLQRKLKSLKNVDVFTNAQTTEITGDQKV
NGLVYKDRATGELKKVELEGVFIQIGLVPNTDWLKGVVELTKHGEIVVDARGQTSVPGVF
AAGDVTTVPFKQIIIAAGDGAKAALGAFDHLIRTSAPVEQATV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccagcaccaaagcccaattgaagagttacctcgaacgcgccacgcagccg
atcgagatcgtcgcctcgctcgacgacagcaaggcctcgggcgaaatgctgtcgctgctg
aaggacgtcgccgaagcgtcgccgctggtcaagctgaccgaaagccgcgacgacaaccat
cgcaagccctctttctcggtcaaccgcccgagcgagaaccacggcccgcgtttcgccggc
ctgccgatgggtcatgaattcacgtcgctgatcctcgcgctgctgcaggtcggcggctat
cctcccaaggtcgaacaggcggtgctcgaccagatccgcgcactcgacggcgacttcgag
ttcgagatctatgtctcgctcacctgccacaactgccccgacgtggtccaggcgctgaat
ctgatggccatccagaacccgcgcatccgcaccaccatgatcgagggcggcaccttccag
gacgaggtcaaggagcgccaggtgatggccgtgcccaccgtgttcctgaacggcaccgaa
ttcggccagggccgcatgagcctggaagagatcctcgcgaagatcgacaccagcggcgtc
gagcgcgaagcgaagaagatcgccgccaaggacccgttcgacgtgctgatcgtcggcggc
ggccccgctggtgccgcggctgccgtgtatgcggcgcgcaagggcattcgcaccggcgtg
gcctcggagcgcttcggcggccaggtgctcgacacgctgggcatcgagaacttcatctcg
atcaaggagaccgaaggaccgaagttcgcccacgccctcgaagagcatgtgcgcgactac
gacgtcgacatcatgaacctgcagcgcgccaaggcgctggtgccgggcaaggacctcatc
gaggtccagctcgagagtggcgcctcgctgaagagcaaatcgatcatcatctcgaccggt
gcgcgctggcgcaacatcaacgtgcccggcgagcacgagttcaagaacaagggcgtggcc
tactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggcggc
ggcaattcgggcgtcgaggcggccatcgacctggccggcatcgtgggccatgtcacgctg
atcgagttcgacaccgcgctgcgcgccgacgccgtgctgcagcgcaagctcaagagcctg
aagaacgtcgacgtgttcaccaacgcgcagaccaccgagatcaccggcgaccagaaggtc
aacggcctggtctacaaggaccgcgcgacgggcgagctgaagaaggtcgaactcgaaggc
gtgttcatccagatcggcctggtgcccaacaccgattggctcaagggcgtggtcgagttg
accaagcacggcgaaatcgtggtcgacgccaggggccagacctcggtgccgggcgtattc
gccgcgggcgacgtgacgaccgtgccgttcaagcagatcatcatcgcggccggcgacggc
gcgaaggcggcgctcggtgctttcgatcacctgatccggacctcggccccggtcgagcag
gcgaccgtctaa

DBGET integrated database retrieval system