KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_20791Help
Entry
VPUCM_20791       CDS       T03116                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00473  D-Alanine metabolism
vph00550  Peptidoglycan biosynthesis
vph01100  Metabolic pathways
vph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VPUCM_20791
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VPUCM_20791
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VPUCM_20791
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vph01011]
    VPUCM_20791
Enzymes [BR:vph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VPUCM_20791
Peptidoglycan biosynthesis and degradation proteins [BR:vph01011]
 Precursor biosynthesis
  Amino acid ligase
   VPUCM_20791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST Peptidase_M55
Motif
Other DBs
NCBI-ProteinID: AHJ01912
LinkDB All DBs
Position
2:845942..846931
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIQNVKVTRVEIKNEGWVTNQGELVYLDL
NTKQLCSNESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDALDIPNTPYLFLTRNDEHAHRQAEQAFEKWGKVFVKAARQGSSVGCYSVTEKQAIA
KAVNDAFGYSDQVLVEKAVKPRELEVAAYEMNGELHITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTQEQIDKIRHASETVFKQMNLRHLSRIDFFLTEDNEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttctattatgcggcggcggctcttctgaacacgaaatttcactg
ttgtcggctaactttgttgaacaacaactaaacctaattcagaacgtcaaagtcactcgc
gtagaaataaaaaatgaaggttgggtcacaaatcaaggcgaattggtttaccttgattta
aacaccaaacaattgtgctcgaatgaatccaatcaaacgatcgactttattgtgccttgt
attcacggctttcctggcgagactggtgacattcaatcactattcgaaattgccggtatt
ccatacttaggatgtggaccagaagcaagcagcaacagtttcaataaaatcacatcaaaa
ctttggtacgacgctttagacattccaaatacaccttacttattcctaactcgcaatgat
gaacacgctcacagacaagctgaacaagcctttgaaaagtggggaaaagtgtttgttaaa
gctgcacgtcagggctcgtctgttgggtgttacagtgtaaccgagaagcaagctatcgct
aaagcagtaaacgatgcgtttggttattcagatcaagtacttgtagagaaagcggtaaaa
cctcgtgagttagaagtcgcagcttatgaaatgaacggtgaactgcacatcactaagcca
ggtgaagtgatcgcacccgatggtgcattttactcatacgatgaaaaatacagcagctca
agccattcattaacagaagtagaagcgaagaacctgactcaagaacagatcgataagatt
cgtcatgcgtcagaaaccgtattcaaacaaatgaaccttcgtcatttgtctcgcatcgac
tttttccttacggaagataacgaaatttacttgaatgaagtgaatacattcccaggaatg
acaccaatttcaatgttccctaaaatgcttcaaaacaatggtcacaagttccatgagttt
cttgaagattgtattaatagtgcaaagtga

DBGET integrated database retrieval system