KEGG   Virgibacillus dokdonensis: A21D_01907Help
Entry
A21D_01907        CDS       T05261                                 

Gene name
ahpF_1
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vpn  Virgibacillus dokdonensis
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A21D_01907 (ahpF_1)
Enzymes [BR:vpn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A21D_01907 (ahpF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 HI0933_like GIDA AlaDh_PNT_C FAD_binding_3 DAO FAD_oxidored Thi4 NAD_binding_7 Glutaredoxin NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AUJ24988
UniProt: A0A2K9IZ49
LinkDB All DBs
Position
complement(2046228..2047757)
Genome map
AA seq 509 aa AA seqDB search
MVLDPEIKSQLQQYLELLENDLVLKVSTGDDKISKDMLALTDELANMSNKITVEHTKLAK
TPSFSINRVGEDSGIAFAGLPLGHEFNSLVLALLQVSGRPPKLDQKMIDQIKSITEEYHF
ETYVSLSCNNCPDVVQALNMMSVLNPNISHTMIDGAAFKDEVESKNIMAVPAVYLNGEFF
NGGRITLEELLEKIGHGVDASELSEKEPFDVLVVGGGPAGASSAIYAARKGIRTGIVAER
FGGQVQDTLSIENFISVKRTEGPKLVANLEEHVNDYNIDVMNSQRAKNLEKKDMFELELE
NGAVLKSKSVIISTGARWRNIGVPGEQEFKNNGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFAPELKADEVLQKRLYSLPNVTVIKNAQTKEITGTDSVNGITY
IDRETKEEKHIELQGVFVQIGLVPNTEWLEGTVERNRMGEILVDKQGQTNVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtactagacccagagatcaagtcacaattacaacaatatcttgaactattagaaaac
gacctagtgcttaaagtaagcactggagacgataaaatatcaaaggacatgctagctctt
acggatgagctagctaatatgtccaataaaataacagttgaacatacaaagctagcgaaa
acaccaagctttagtattaatcgtgtcggggaggattcaggcattgcgtttgctggtctt
ccacttgggcatgaatttaattcactcgtcttagctctcttacaggtgagtggcagaccg
ccaaaattagatcaaaaaatgattgaccaaattaaaagcattacagaagaatatcacttt
gaaacatatgttagtctaagctgtaacaactgtcctgacgtggttcaagcgttaaatatg
atgagcgtactcaacccaaatatttcgcatacgatgattgacggtgcagcgtttaaagac
gaagtagaaagcaagaacattatggcagttccggctgtctatttaaatggagaattcttt
aatggtgggcgaatcacccttgaagagttactagaaaaaatcggacatggtgtagatgcc
tctgagctttctgaaaaagagccctttgacgttcttgtcgtcggcggtggtccagcaggt
gctagctcagctatatatgctgctcgtaaaggaatccgcactggtatcgttgctgaacgc
tttggcggtcaagttcaagatacacttagtatcgaaaactttattagcgtcaagcgcaca
gaagggcccaagctagttgctaacctagaagaacatgtcaatgattacaacattgatgtc
atgaactctcaacgcgccaaaaacctcgaaaagaaagatatgtttgagcttgaactggaa
aatggcgctgtactaaaaagtaaaagtgtcatcatttctacaggcgctcgttggcgaaac
atcggcgttcctggcgaacaagaatttaaaaacaacggtgtagcatattgtccacactgt
gacggtccattattcgaaggaaaagatgtcgctgttatcggcggaggtaattctggaatt
gaagcagctatcgacctcgctggaattgtgaagcatgtcacggtacttgaattcgcgcca
gaactaaaagctgacgaagtgttacaaaaacgcttgtacagcttaccaaacgtaacagtc
attaaaaatgcccaaacaaaagaaatcactggtactgacagtgtaaatgggattacctat
atcgatcgtgaaacaaaagaagaaaaacatattgaacttcaaggtgtattcgtacaaatt
ggactcgttccaaatacagaatggcttgaaggcactgtagaacgcaaccgcatgggtgaa
atccttgtagacaaacaaggacaaacaaacgttcccggcttgtttgccgcaggagattgt
accgacagtgcttataaccaaattatcatttctatggggtcaggcgcaactgctgcttta
ggcgcatttgactacttgatccgtaattga

DBGET integrated database retrieval system