KEGG   Veillonella parvula: Vpar_0824
Entry
Vpar_0824         CDS       T01130                                 

Definition
(GenBank) sulfatase
  KO
K19353  heptose-I-phosphate ethanolaminephosphotransferase [EC:2.7.8.-]
Organism
vpr  Veillonella parvula
Pathway
vpr00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Vpar_0824
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
    Vpar_0824
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     Vpar_0824
Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
 Core region
  Vpar_0824
SSDB
Motif
Pfam: Sulfatase
Other DBs
NCBI-ProteinID: ACZ24505
UniProt: D1BM98
LinkDB
Position
complement(966655..968487)
AA seq 610 aa
MSSSVRQIGRNPIFRFGIIGIVLYIILFLIYEPITLGLDVEDITILAVPTIVGTFLFQYF
MGCTVFHRPFLGYGLVGILWALTFPLLFHWSYVKPLYFYEFANDFLFGLLIFMGLSGIQF
LLNQTNRFHKTTSLIMAIISMILSLIPFLQIGYYMTTWHCLTPASLLAVYMTNPEEAFGF
LKNAAGIPGLIAISIGLILWTYLLYWSNLGMKAVVNLNTTRPMRSAMLIASLVAFLVYVP
FFLFPQTCIVANWIAAGDYVKQMQQYNDNHHLVFDSFNLDTKETAVNKTPGTIILVIGES
SSRDYMKVYNPNFPYDDTPWQGNMRSDNKDFVFFDNAYSSYVQTVPTLERALSERNQYDD
KPFLDSANILDIAKKAGYTTSWFSNQGVFGEYDTAISLMAKTADTTKWAHESYAFSDRYD
EALLPLLETVDPTKNNFIVIHIMGSHIYYNDRYPHEFSKWKQGPYPDGQEAYANSQLYTD
WLLQQIYNYGKDKLNLQAMVYFSDHGESLDKSHNPDTFDFVMTHIPFWVYLSPQYRSTYP
QTAEVLAKHEHQFFTNDLLYDTLVGLMHAPSQRYDATRDFSNAQYRFNLHNLTTLLGEQP
LANDPVNANK
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgtcatcgagtgtgaggcaaattgggcgaaatccaatttttcgctttggtattataggt
attgttttatatatcatcttatttttaatttatgagcccataactttagggcttgatgta
gaggatattacgattttagctgtaccaacaattgtaggtacctttttatttcaatatttt
atggggtgtaccgttttccacaggccttttttagggtatggcctagtcggaatcttatgg
gcacttacctttcctcttttattccattggtcctatgtgaagccattatacttctatgaa
tttgctaatgattttttatttggcttattaattttcatgggattatcaggcattcagttt
ttactgaaccaaacaaatcgcttccataaaacaacatccttaatcatggctatcatttcc
atgattctgagcttaataccattcttacaaattggctattacatgactacttggcattgc
ttaacgccagccagtctgctagccgtatatatgaccaatccagaagaagcatttggtttt
ttaaagaatgcagctggaatacctggtcttatagcaataagtattggtcttatcttatgg
acttatttattgtactggtctaacttaggaatgaaagcagtagtaaacttaaatactaca
cgtcctatgcggtcagctatgctcatcgcatcccttgtagcttttttagtatatgtacca
ttcttcttgttccctcaaacctgtattgtggcgaactggattgctgcaggcgattatgta
aaacaaatgcaacaatataatgataatcaccacttagtatttgattcctttaatttagac
acaaaggaaacagcggtgaacaaaacacctggtactattattctagtcattggcgaatct
agttctcgagattatatgaaagtatataatccaaacttcccatatgacgatactccatgg
caaggcaatatgcgttcggacaataaagactttgtcttctttgataatgcctattcatcg
tacgtacaaacagtaccaaccttggagcgtgcactatctgaacgaaatcaatatgatgat
aaaccatttcttgattcagccaatatcttagatattgctaaaaaagcgggatacacgact
tcttggtttagcaatcaaggtgtattcggtgaatatgatacagctatttcattaatggct
aagactgcagacacaacaaaatgggcccatgaatcttatgcattctcagatcgatatgat
gaagctctattgccattattagaaactgtagatcctaccaaaaacaactttatcgttata
catattatgggtagtcatatttattacaatgaccgttaccctcatgaatttagcaagtgg
aagcaaggtccgtatcctgatggtcaagaagcatatgctaacagccaattatacacagac
tggttattacaacaaatttacaattatggcaaagacaaattaaacttacaagccatggtg
tatttctccgatcacggtgaaagtttagacaaatcgcataaccctgatacatttgatttt
gttatgacacatattccattctgggtatacctatctccacaatatcgctcaacctatcca
cagactgctgaggtacttgcaaaacacgagcatcaattctttactaatgatttgctatac
gatacattagttggtctcatgcatgctccaagtcaacgatatgatgcaacacgagatttt
agtaatgctcaatatcgatttaatctacataacttaactacattacttggtgaacaacca
ttagcaaatgatcctgttaatgcaaacaagtag

DBGET integrated database retrieval system