KEGG   Veillonella parvula: Vpar_1348
Entry
Vpar_1348         CDS       T01130                                 

Definition
(GenBank) putative PTS IIA-like nitrogen-regulatory protein PtsN
  KO
K02821  ascorbate PTS system EIIA or EIIAB component [EC:2.7.1.194]
Organism
vpr  Veillonella parvula
Pathway
vpr00053  Ascorbate and aldarate metabolism
vpr01100  Metabolic pathways
vpr01120  Microbial metabolism in diverse environments
vpr02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Vpar_1348
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Vpar_1348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpr02000]
    Vpar_1348
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     Vpar_1348
Transporters [BR:vpr02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component
    Vpar_1348
SSDB
Motif
Pfam: PTS_EIIA_2 AAA_33
Other DBs
NCBI-ProteinID: ACZ25026
UniProt: D1BNR9
LinkDB
Position
complement(1540901..1541356)
AA seq 151 aa
MIQDLLSEDNVSFHYPAETWEDVIRHGGQLMVDAGFTDPSYTEAMVEVVREMGPYIVLAP
GLAMPHARPEHGAKRVGTALVTLEKPLNFGSPDNDPVSVALFLCAPNKDEHIQLLTDIAT
LFEDEEFLDAAVDFESIDDVQAFLAEHLDEQ
NT seq 456 nt   +upstreamnt  +downstreamnt
ttgatacaagatttattatctgaggataatgtatcctttcattatcccgccgaaacgtgg
gaagatgtaattcgtcatggtggtcaactgatggttgatgcgggctttacggatccatct
tatacagaggctatggttgaagtagttcgcgaaatgggtccatatatcgtattggctccc
ggtcttgctatgccacatgcgcgcccagaacatggtgctaagcgtgtagggacagcttta
gtgacattggaaaaaccattgaattttggtagtcctgataatgacccagtatctgtcgca
ttattcttatgtgctcccaataaagatgagcatattcaattgttaacagatattgctaca
ttatttgaggatgaagaattcttagatgcggccgttgactttgaaagtattgacgacgta
caagcattcttggcagaacatttagacgagcaataa

DBGET integrated database retrieval system