KEGG   Veillonella parvula: Vpar_1561Help
Entry
Vpar_1561         CDS       T01130                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
vpr  Veillonella parvula
Pathway
vpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Vpar_1561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpr02000]
    Vpar_1561
Transporters [BR:vpr02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Vpar_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_23 AAA_16 AAA_15 AAA RsgA_GTPase AAA_33 MobB AAA_30 oligo_HPY AAA_7 AAA_19 NACHT ATP-synt_ab TsaE FtsK_SpoIIIE Mg_chelatase AAA_24 PRK AAA_18 MMR_HSR1 Zeta_toxin Rad17
Motif
Other DBs
NCBI-ProteinID: ACZ25237
UniProt: D1BPD0
LinkDB All DBs
Position
complement(1774756..1775553)
Genome map
AA seq 265 aa AA seqDB search
MAENILTVENLNIAYQGVPAVMDVNFTLERGKVLTIVGESGSGKTTVIRALMGLLPVGGE
VTDGTMIFNGHDLRNLSKSEWRSLRGKDMAMIFQDSGSALDPIVRIGKQFRELFKSHIEI
TNDECDRRAIELLESVSLPNGADILRRYPHELSGGQRQRVGIAMALALDPALLIGDEPTS
ALDVTTQSQVVMQMLDLAKEHNSAIVMVTHNLGVAAYMSDYIIVMKKGRVVDAGTPKDIL
ENPSNEYTKQLKEAVPTLGGGRYID
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaacatactaactgtagaaaaccttaacattgcgtaccaaggtgtgcctgct
gttatggatgtgaactttaccttggaacgcggtaaggtattaaccattgtaggtgagtcc
ggatccggtaaaactactgtaatccgggccctcatgggtttattacctgtaggtggtgag
gttacggacggtacaatgatctttaatggtcatgaccttcgtaacttgtctaaatctgaa
tggagatctttgcgcggcaaggatatggccatgattttccaagatagtggtagtgcatta
gatccaatcgttcgtatcggtaaacaatttagagaattgtttaaatcccatattgaaatc
actaatgatgaatgtgatcgacgagcaattgagttattagaatctgtatctcttcctaat
ggagcggatatattgcgccgttatccacacgaattatctggtggacaacgacaacgtgtt
ggtattgccatggcgttagctttggatcctgcattactcatcggtgatgaaccgacatct
gcgctagatgtaacgacacaatctcaagtggttatgcaaatgcttgacctagctaaagag
cataactccgcaatcgtaatggtaacccataatcttggtgtggcggcgtatatgtccgac
tacattatcgttatgaaaaagggccgtgtcgtagatgcaggtactcctaaagacattttg
gaaaatccatctaatgaatatacgaaacaattaaaagaggctgtaccaacattgggagga
ggtcgttacattgactaa

DBGET integrated database retrieval system