KEGG   Vigna radiata (mung bean): 106756275Help
Entry
106756275         CDS       T04126                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra03030  DNA replication
vra03410  Base excision repair
vra03420  Nucleotide excision repair
vra03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vra00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106756275
   03410 Base excision repair
    106756275
   03420 Nucleotide excision repair
    106756275
   03430 Mismatch repair
    106756275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vra03032]
    106756275
   03400 DNA repair and recombination proteins [BR:vra03400]
    106756275
Enzymes [BR:vra01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106756275
    6.5.1.6  DNA ligase (ATP or NAD+)
     106756275
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106756275
DNA replication proteins [BR:vra03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106756275
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106756275
DNA repair and recombination proteins [BR:vra03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106756275
   NER (nucleotide excision repair)
    Other NER factors
     106756275
   MMR (mismatch excision repair)
    Other MMR factors
     106756275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase AKNA RPN7
Motif
Other DBs
NCBI-GeneID: 106756275
NCBI-ProteinID: XP_014494127
UniProt: A0A1S3TK42
LinkDB All DBs
Position
2
AA seq 797 aa AA seqDB search
MLPLHFRSSFGSSFRLCFCFSRTVRVSSLVSFPLSLFSVSLRVMSKPPSAFDALMSAAKK
NSKSKTSKLSSPPKKRKSPLSTSSQNPSNPKSPKLPSPPITVVEPEQAVKQEELVKPVKQ
EELVKPEAVKPEPRKVRQLLTSSSSKGKTEELKKQVPQLKQKPSSFDPASIIAWEKGQPV
PFLFLALAFDMISQESGRIVITDIVCNMLRTVMLTTPEDLVPVVYLSANRIAPAHEGLEL
GIGESIISKALAEAYGRNENWIKTQYQKKGDLGLVAKESRSSQPMMWKPEALTIRKVFNT
FRLIAKESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGYAEQTLLAALGQAA
VYTEEHSKPPPEIQSPLDKASDIVKQVYSVLPDYDKIISALLTEGLWKLPKTCKFTPGVP
IRPMLSKAAKSVTEVLNKFQDVEFTCEYKYDGERAQIHYLENGSVEIYSRQAERNTEKFP
DVAAAVSRLKKTSVSSFILDCEIVAYDRATQKLLSFQTLSTRARKKVEIEDIKVNVCVFA
FDLLYLNGQELLQENLRVRREHLYASFEEESGFLQFATALTSNDVEEIQNFLDQAVGASC
EGLIIKTLNEDATYEPAKRSLNWLKLKKDYMDNLGDSVDLVPIAAFHGRGKRTGVYGAFL
LACYDNNNEEFQTICKIGTGFSESVLVERSSSLRSQVISKPKSYYRFGETINPDVWFEAS
EVWEVRAADLTISPVHRAAAGIVDPNKGISLRFPRLVRVRHDKAPEQATSSEQIAELYKA
QKYNQANKQDDEDEEDY
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgctcccattgcattttcgatcctcttttggttcttcttttcgtctatgtttctgtttc
tctcgaactgttagggtttcgtctctcgtctctttccctctgtctctcttctctgtctct
ctccgcgtcatgtctaagccaccctccgccttcgacgctctcatgtccgccgctaagaag
aattccaaatccaaaacatccaagctttcatcacctcccaagaaaagaaaatctccactc
tccacttcttcacaaaatcctagcaaccccaaatcccccaaattgccttctccgcccata
actgttgttgaaccggagcaagcagttaaacaagaagaacttgttaaaccagttaaacaa
gaagaacttgttaaaccagaagctgttaagccggagccgcggaaggtacgccaactgtta
acgtcttcttcttcgaaggggaagaccgaggagctgaagaagcaagttccgcagctgaag
cagaagccttccagtttcgatcccgcttcgattattgcatgggagaagggacagcccgtg
ccgtttctctttctcgccttggcattcgatatgatttctcaggaaagtggaagaatagtc
atcactgacattgtttgcaatatgctgcggactgtgatgctgaccacgccagaggatctt
gttcccgtcgtttacctctccgcaaatcggattgcgcctgctcatgaaggattggaattg
ggaatcggcgagtcgatcatttccaaggcgctcgctgaggcttatggaaggaacgagaat
tggattaagactcagtatcagaaaaaaggtgatttaggcttggttgctaaagagagtcgt
tcgtctcaacctatgatgtggaagcctgaagcattaaccatcaggaaggttttcaacact
tttcgccttattgctaaggaatctggaaaagacagtcaagagaaaaaaaagaatcatatc
aaggcacttctcgttgctgcaactgactgtgaacctcaatatctaattcgtttgcttcag
acgaagttgcgaattggttatgcagaacaaactctgttggctgcactaggccaagctgca
gtatacactgaagaacactctaaaccgcctcctgaaattcagtctcctttagacaaggct
tcggatattgttaaacaagtctattctgttcttcctgactatgacaaaataatatctgca
ctgcttacggagggtctatggaagcttccaaaaacttgtaaatttactccaggtgttcca
attagacctatgctatcaaaggcagcaaaaagtgtaactgaagttctgaacaaattccag
gatgtggaatttacctgtgaatacaaatacgatggagagcgtgcccagatacattacctg
gagaatggttcagttgagatttacagtagacaagcagaacggaacactgagaagtttcct
gatgttgctgctgcagtttcaaggttgaagaaaacaagtgtatcttcatttattcttgat
tgtgaaattgtcgcatatgatcgtgcaacacaaaaacttctttctttccagaccctcagt
actcgagctcgcaagaaagtagaaattgaagatataaaggttaatgtctgtgtatttgct
tttgatttgttgtatctaaatggccaagaacttcttcaggaaaaccttagagtccgcaga
gagcacctttatgcctcttttgaggaagaatctggttttcttcagtttgcaacagcatta
acttcaaatgatgttgaggagatacagaattttcttgaccaagctgttggtgctagttgt
gagggattgattattaagacattaaatgaggacgctacatatgaacctgccaagcgatca
ctcaactggctaaaactgaagaaagattatatggacaatttaggggactctgtagacttg
gtacctattgctgctttccatgggcgtggtaaacgtacaggagtttatggtgccttcctc
cttgcttgctatgacaacaataatgaagaatttcaaactatttgcaagattggaacgggg
ttctctgaatctgtacttgtagaacgttcttccagtcttcgttctcaagtgatttccaag
ccgaagtcgtactatagatttggggaaacaatcaatcctgatgtctggtttgaagccagt
gaggtgtgggaggtgagagcggcagacctgaccattagccctgtccaccgtgctgcagcg
ggcatagtagatccgaacaagggcatctctcttcgttttccaaggctggttcgagtccgg
catgacaaagctcctgaacaggccacatcatctgagcagattgctgagttgtataaagcc
caaaaatacaatcaagcgaacaaacaagatgacgaagatgaagaagattattga

DBGET integrated database retrieval system