KEGG   Vibrio mediterranei: BSZ05_22500Help
Entry
BSZ05_22500       CDS       T04936                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vsh  Vibrio mediterranei
Pathway
vsh00473  D-Alanine metabolism
vsh00550  Peptidoglycan biosynthesis
vsh01100  Metabolic pathways
vsh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSZ05_22500
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSZ05_22500
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSZ05_22500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vsh01011]
    BSZ05_22500
Enzymes [BR:vsh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSZ05_22500
Peptidoglycan biosynthesis and degradation proteins [BR:vsh01011]
 Precursor biosynthesis
  Amino acid ligase
   BSZ05_22500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: ASI92565
UniProt: A0A241TC66
LinkDB All DBs
Position
2:complement(1270706..1271701)
Genome map
AA seq 331 aa AA seqDB search
MSELNILLLCGGGSAEHEVSLVSANFLESQLKLNPRFNVTRVEITQEGWKCSDGHLVVLD
LNQKALVNDQQTLHIDYVVPCIHGFPGETGDIQSLFEMAGIPYLGCGPEASSNSFNKITS
KLWYDTLDIPNTPYLFLTENDKSAHTIAAQAFEKWGKVFVKAAKQGSSVGCYSVTNIEQL
GASINSAFGYSDQVVIEQSVKPRELEVAAYEYKGRLYVTKPGEIIAPDGAFYTYDEKYSA
DSHSTTTVEASDLTDEQLEIIHTCAVKVFTQMKLRHLSRIDFFLTEDNKIYLNEVNTFPG
MTPISMFPKMVEHSGLEFSEFLSDCIESSFR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactcaatatccttcttctatgtggtggtggctctgctgagcacgaggtgtct
ctcgtttcagctaactttctagaaagccaactcaaactcaatcctagattcaatgttacc
cgggttgaaataactcaagagggctggaagtgcagtgatggtcatttagttgttttagac
cttaatcaaaaagcccttgttaatgatcaacaaactctacatatagattacgttgttcct
tgtattcacggtttccctggtgaaaccggcgatattcaatctctttttgagatggctggt
attccgtatttgggctgtggtcctgaagctagtagcaatagctttaacaaaatcacctca
aagctgtggtatgatacattagacatacctaatacaccttatctattccttaccgaaaac
gataaatccgctcatactatagctgctcaagcttttgaaaagtgggggaaagtgttcgta
aaagccgcaaagcagggctcttctgtaggctgttacagtgtaactaatatcgaacagtta
ggtgctagtattaactccgcttttggttattcggaccaagttgttattgagcagtcagta
aaaccaagagagcttgaggtcgcagcgtacgagtacaaaggacgattgtacgtcaccaag
cctggtgaaattattgctcctgatggtgcattttatacttatgatgaaaagtacagtgca
gacagtcattcaactacaacagtagaagcgagtgacctgacagacgagcagttagaaatc
attcatacctgtgcggttaaagtattcactcaaatgaaactcagacacttatcaagaatt
gatttctttttgacagaagataacaagatttacctaaacgaagttaacacttttccaggt
atgactccgatttctatgtttccaaagatggtcgagcattctggtcttgagttctctgag
ttcttgtcggactgtattgaatcttcattccgttaa

DBGET integrated database retrieval system