KEGG   Vibrio tapetis: B0484
Entry
B0484             CDS       T05424                                 

Definition
(GenBank) putative SENSORY TRANSDUCTION HISTIDINE KINASE
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
vta  Vibrio tapetis
Pathway
vta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vta01001]
    B0484
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vta02022]
    B0484
Enzymes [BR:vta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     B0484
Protein kinases [BR:vta01001]
 Histidine kinases
  OmpR family
   B0484
Two-component system [BR:vta02022]
 OmpR family
  RstB-RstA
   B0484
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HAMP
Other DBs
NCBI-ProteinID: SON52095
UniProt: A0A2N8ZJM2
LinkDB
Position
B:complement(487927..489570)
AA seq 547 aa
MVKAINFVQTSANGALMIKAFSLLWLVILILIAFFFNPITANPITKISEIISKDIYQELY
GPTLRTIHEDLTSQPPQDWQQTIQNLQPHFGMQLKLVDIAELPLSPANLTSIKEGEMAYH
IADPSALVMGIKQSEQAIYLAMDLASDDYGKLQASGPIFLLVREMKKLPRDQRSVQLNKI
TLSMPVAATIEHFDSIELPEDQKSLLLAGEIASVINENEDQILFALIEDKDILRVIDDQS
TSVQILFMGAIVMGIMLCIAAVMMLWAIPLWRDLKRLVSTTNQYGNGDLQARAKTSKWSV
VAQLGTSFNQMANNVEKLVLGHRDLTNAIAHDLRTPLYRLRFALEMLKDNEISKENKEKY
NRSVDKSMDDLDHLINQTLILSRYSRSAPNANQIVPCVLQPILRSEINHFHLEHPSLSVE
FNCATLIESEEVMVDQRAMIRAMNNLLSNAARYAKSRVDVTFERHTKGWVLIIEDDGIGI
PQDLWESIFDPFTQVDNEERNTTTGYGLGLAIVKQIAIWHEGDAFVSQSALGGAKFTLCW
DVMRTGS
NT seq 1644 nt   +upstreamnt  +downstreamnt
gtggtaaaggctatcaactttgtccaaacaagcgctaatggggcactcatgattaaggca
ttttctcttctttggttggtgatactgatactcatcgcgtttttctttaaccccattacg
gctaaccctatcaccaaaatcagcgagataatttccaaagatatctatcaagagctttac
gggccgacgttacgaacaatccatgaagacttaacttcccagcctccacaagattggcaa
caaaccatacaaaacctacagcctcattttggtatgcaactcaaacttgtcgatatagca
gaactcccgttaagtcctgcgaacttaacaagcatcaaagaaggagaaatggcctaccat
attgccgatccttcagctttggttatgggcataaagcaaagtgaacaagcgatatatctc
gcgatggatctagcgagtgatgactatggaaaattgcaggccagcgggccgatattctta
ctcgtgcgtgaaatgaaaaaattaccccgagatcagcgcagtgttcaattgaataaaatc
accttatcaatgccagtcgccgccaccattgaacactttgattcgatagaactgcccgaa
gatcagaaatctctgcttctggccggagaaattgcgtctgtaattaacgaaaacgaagat
cagatcctctttgctctcattgaagataaggatattttacgggtaatcgatgatcaatcg
acgtctgtccaaatactgttcatgggggcgattgttatggggatcatgctgtgcattgcg
gcagtcatgatgttatgggccattcctttatggcgcgatttaaaacgcctcgtctcgaca
acaaaccaatatggtaacggtgatctgcaagctcgtgcaaaaacgtctaaatggtccgtc
gttgctcaactgggcacatcatttaaccaaatggccaataacgtcgaaaagctggtactt
gggcatcgtgacctaaccaatgcaattgcacatgacttaagaacgccactctataggctg
cgatttgctttagagatgctgaaggacaatgaaatatccaaagagaacaaagaaaaatac
aacagatcggtagataaaagcatggatgacctcgaccatctcatcaatcaaaccttgatc
ctttctcgctattctcgcagtgcgcctaatgctaaccaaatcgtgccatgtgtattacag
cccatattacgctctgaaataaaccattttcatttagagcacccatcgttgtctgtggag
tttaattgcgccacattaattgaatcagaagaagtgatggtcgaccaaagagccatgatc
cgagcgatgaataacttactttcaaacgctgccagatacgctaaaagcagggtcgacgtt
acttttgagcgccatactaaagggtgggttctaatcatagaagatgatggtatcggcatt
ccacaagacttatgggaatcgatttttgatccctttactcaggtcgataatgaagaaaga
aataccacaacagggtacggattaggtttagcgatagtgaagcagattgccatttggcat
gaaggggatgcattcgtttcgcaatctgcgctggggggcgctaagttcaccttatgttgg
gatgtgatgcgcacaggcagttaa

DBGET integrated database retrieval system