KEGG   Vagococcus teuberi: BHY08_03900
Entry
BHY08_03900       CDS       T04578                                 

Definition
(GenBank) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
vte  Vagococcus teuberi
Pathway
vte03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:vte00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BHY08_03900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vte03400]
    BHY08_03900
DNA repair and recombination proteins [BR:vte03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BHY08_03900
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BHY08_03900
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_29 AAA_22 AAA_21 AAA_14 AAA_23 AAA_33 AAA_24 APS_kinase ATPase MMR_HSR1 AAA_18 AAA_25 NACHT cobW Viral_helicase1 NB-ARC T2SSE RNA_helicase DnaJ_CXXCXGXG PRK MeaB NTPase_1 Septin DUF87 Cytidylate_kin FtsK_SpoIIIE Dynamin_N
Other DBs
NCBI-ProteinID: APB31045
UniProt: A0A1J0A524
LinkDB
Position
813916..816738
AA seq 940 aa
MANDKIVIHGARAHNLKNIDVTIPRDKLVVITGLSGSGKSSLAFDTLYAEGQRRYVESLS
SYARQFLGQMDKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTEINDYLRLLFARVGEP
ICPNDGTKISSQSPEQMTDKLLELEERTKIQILAPLIRGKKGQHKKVFEKIKKDGFVRVR
VDGKTYDISEVPELEKNKKHDVEIIVDRIVIKDGVRSRLFDSLELALRLADGYVLVDIMD
QEEMLFSEHYACPYCGFTVGDIEPRLFSFNTPFGACPECDGLSVKLEVDADLVVPDETKT
LREGAIAPWNPISSNYYPNMLEQACEQFGIDFDIPFKDLTKEQKELLFRGSGEKTFHFHY
KNEFGGVRDVDIPFEGILTNINRRYHETNSDYTREQMKLYMTELTCETCQGYRLNKEALS
VKIDGKHIGEISELSVNHSLNYMSELNFGEQDTMISQPILKEIRDRLSFLENVGLGYLTL
SRSAGTLSGGEAQRIRLATQIGSNLSGVLYILDEPSIGLHQRDNNRLIDSLKKMRDLGNT
LVVVEHDEDTMRAADYLIDIGPGAGEQGGQIISAGTPEEVEKDKNSLTGQYLSGRRKIDV
PKERRKGNGESVKITGAKENNLKNLSVEFPMGKFVAVTGVSGSGKSTLVNTILKKALAQK
INRNSAKPGKFDKITGYESIEKIIDIDQSPIGRTPRSNPATYTSVFDDIRDLFAKTNEAK
TRGYKKGRFSFNVKGGRCEACRGDGIIKIEMHFLPDVYVPCEVCHGQRYNSETLEVRYKG
KNIAEILEMTVEDAVEFFQAIPKIHRKLQTIVDVGLGYVKLGQSATTLSGGEAQRMKLAS
ELHKRSSGKNFYILDEPTTGLHTEDISRLLEVLNRLVDSGNTVLVIEHNLDVIKTADYVI
DLGPEGGEGGGTIIATGTPEDIIKVEESYTGYYLKEIMEC
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggcaaatgacaaaatagtaatacatggtgcaagagcacataatttaaaaaacatagat
gtaacgattccaagagataaactcgtcgtgattacggggctttctggctcaggaaaaagt
tcattagcatttgacacgttatacgctgaagggcaacgtcgttatgtcgaaagtttgtcc
tcatacgcacgacaatttttagggcaaatggacaagccagatgttgatagtattgatggg
ttgagtccagcaatttcaatcgaccaaaaaacaaccagtaaaaatccacgatcaacggtt
gggaccgtcacagagataaatgattatttaagactattatttgctcgagtaggtgagcct
atttgtccaaatgatggcacgaaaattagtagtcagtctccggaacaaatgacagataag
ttgttagagttagaagaaagaacgaaaattcaaattctagcaccactcattcgtggaaaa
aaaggacaacacaaaaaagtatttgaaaaaatcaaaaaagatgggtttgtccgagtaaga
gttgatgggaaaacctatgacatttctgaagtgccagagttagaaaaaaataaaaagcat
gatgttgaaattatcgttgaccgtattgtgataaaagatggggttcgctcaagattattt
gactcacttgaactggcattacgattagcagatggctatgtattggttgatattatggat
caagaagagatgctatttagcgaacattatgcatgtccttattgcggctttacagttggc
gatattgagcctcgattgttctcatttaatacaccatttggagcgtgtccagagtgtgat
ggattgagtgttaaattagaggttgatgcagacttggttgttccagatgagacgaaaaca
ttacgtgaaggggcaattgcaccgtggaatccaatcagctcaaattattaccccaatatg
ttagagcaagcttgcgagcaatttggcattgattttgatataccatttaaagatctgact
aaagagcaaaaggaattattatttagaggatcaggagaaaaaaccttccattttcattat
aaaaacgaatttggtggcgtgcgtgatgttgatattccatttgaagggattttgactaat
ataaatcgccgttatcacgaaacaaatagtgattacacgagagaacaaatgaagctatat
atgactgaattaacgtgtgaaacgtgtcagggctatcgtttaaataaagaagctttatca
gtgaaaatagatggaaaacatattggagaaatcagtgaattatcagtgaatcattcgtta
aactatatgtctgagctaaactttggcgaacaagatacaatgatttcacaaccaatttta
aaagaaattagagatagattgagtttcttagaaaacgttggattaggctatttgactctt
agccgttcagctggaacactgtctggtggagaagcacaacgtattcgtttagcaacccag
attggttcaaatctttcaggggttttatacattttagatgagccatctattgggttacat
caacgagacaataatcgtttgattgattcattgaaaaagatgcgtgatttaggcaataca
ttagttgttgtggaacatgatgaagatacaatgagggcagctgattatttaattgacatc
ggacctggagcaggagagcaaggtggacaaattatttcagctggcacgcctgaagaagtg
gaaaaagataaaaattcattgacaggtcaatatttatcgggtaggagaaaaattgacgtg
ccgaaagaacgtcgtaaaggtaatggagaaagtgtaaaaattactggagcaaaagaaaat
aacttgaaaaatctatctgttgagtttccaatggggaaatttgtcgcggttactggtgtg
tctggttctggaaagagtacattggttaatacgattttaaagaaagctctggctcaaaaa
attaatcgtaattcagctaaacctggtaagtttgataagattacaggctatgaatcgatt
gaaaaaatcattgatattgaccaaagtccgattggacgaacaccaagaagtaatccagca
acttatacgagtgtgtttgatgatatacgtgatttatttgctaaaacaaatgaagctaaa
acacgtggttataaaaaaggtcgtttcagttttaatgtgaaaggcggaagatgtgaagca
tgtcgaggtgatggaatcatcaaaatcgaaatgcatttcttaccagatgtttatgtacca
tgtgaagtgtgtcatggacaacgctataattctgaaacactagaagttcgatataaagga
aaaaacattgctgagattttagaaatgacagtggaagatgccgtggaatttttccaagca
attcctaaaattcatcgaaaacttcaaacgattgttgatgtcggacttggttatgtcaaa
ctaggtcaatcagcaactaccctatctggtggggaagcgcaacgtatgaagttagcaagt
gagttacataaacgctcgtcaggtaaaaatttctatatattagatgaaccaacaacaggt
cttcatacagaagatattagtcgacttctagaagtattgaatcgtttagtagatagtggc
aatacagtccttgttattgaacataatctagacgtcataaaaacagcagactacgtcatt
gatttagggccagaaggtggagagggcggtggcacgatcattgcaactggaacacctgag
gatattattaaagtagaagaaagctatacaggctattatttaaaagaaattatggaatgt
tga

DBGET integrated database retrieval system