KEGG   Vibrio tubiashii: IX91_19605Help
Entry
IX91_19605        CDS       T03445                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00473  D-Alanine metabolism
vtu00550  Peptidoglycan biosynthesis
vtu01100  Metabolic pathways
vtu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IX91_19605
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IX91_19605
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    IX91_19605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vtu01011]
    IX91_19605
Enzymes [BR:vtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IX91_19605
Peptidoglycan biosynthesis and degradation proteins [BR:vtu01011]
 Precursor biosynthesis
  Amino acid ligase
   IX91_19605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AIW16301
UniProt: F9SZW8
LinkDB All DBs
Position
2:complement(899140..900132)
Genome map
AA seq 330 aa AA seqDB search
MTNTTILLLCGGGSSEHEVSLVSADFLQSQLESTQGFNVVRIEMNADGWFTNDGELAYLD
TNAGTINTDSSSTKLDFVIPCIHGFPGETGDIQSMLELSGIPYLGCGPEASTNSFNKITS
KLWYDALGIPNTPYIFLSENNQDAYARSEAAFKEWGSVFVKAARQGSSVGCYKVTDASQL
QKALDDAFGYSDQVLVEQAVKPRELEVAAYEYEGKLHISKPGEIIAPEDAFYSYEEKYST
SSHSITKVEASDLSQEQLEVIRQSSEKVFTQMRLRHLSRIDFFLTPDGKIYLNEVNTFPG
MTPISMFPKMLEHNGHSFADFLANCVKTSL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacgactattcttctcctttgcggtggtggttcttcagaacatgaagtttca
cttgtttccgccgatttcttgcagtctcaattagaatcaactcaaggctttaatgttgtt
cgcattgaaatgaacgcagatggttggttcaccaatgatggtgagcttgcttatctcgat
accaatgcgggcacaattaacacggattcaagttcgaccaaattagattttgtaattcct
tgcattcatggattcccaggtgaaacgggtgatatccaatctatgctagagctatcaggt
attccttatttaggttgcggcccagaggcgagcactaatagctttaacaaaatcacctct
aagctttggtatgacgcactaggcattcctaatactccttacattttcttgtctgaaaac
aatcaagatgcctacgcgcgcagtgaagctgcgtttaaagagtggggctctgtgttcgtt
aaagcggctagacaggggtcttctgtgggttgttacaaggtaacggatgcttcacaactt
cagaaagcgcttgatgatgcattcggttattcagatcaagtattagtcgaacaagcagtt
aagccgagagagcttgaagtagcggcgtatgagtacgaaggtaaacttcacatatctaag
cctggtgaaatcattgcaccagaagatgctttctatagctacgaagagaagtacagcaca
tcaagtcattcaataaccaaggtagaggcatcagatctcagccaagagcaacttgaagtt
atccgtcaaagttcagaaaaagtatttactcagatgcgtttacgccatctatctcgcatc
gacttcttcttaacacctgatgggaagatttacctaaatgaagttaacaccttcccagga
atgactccaatttcgatgttcccgaaaatgctagagcataatggacactcgtttgcggac
ttcttggcaaactgtgttaaaacttcgctctaa

DBGET integrated database retrieval system